Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 742268..742860 | Replicon | chromosome |
Accession | NZ_CP117820 | ||
Organism | Xylella fastidiosa strain ICMP 8740 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A060HCK8 |
Locus tag | PT012_RS03365 | Protein ID | WP_004085590.1 |
Coordinates | 742564..742860 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PT012_RS03360 | Protein ID | WP_004085592.1 |
Coordinates | 742268..742561 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT012_RS03325 (PT012_03325) | 738722..738988 | - | 267 | WP_004087087.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PT012_RS03330 (PT012_03330) | 738972..739199 | - | 228 | WP_004091377.1 | DUF6290 family protein | - |
PT012_RS03335 (PT012_03335) | 739310..740080 | + | 771 | WP_274169884.1 | hypothetical protein | - |
PT012_RS03340 (PT012_03340) | 740080..740397 | + | 318 | WP_012382585.1 | hypothetical protein | - |
PT012_RS03345 (PT012_03345) | 740394..741224 | + | 831 | WP_027700631.1 | hypothetical protein | - |
PT012_RS03350 (PT012_03350) | 741221..741862 | + | 642 | WP_012382583.1 | Gp138 family membrane-puncturing spike protein | - |
PT012_RS03355 (PT012_03355) | 741859..742212 | + | 354 | WP_027700632.1 | hypothetical protein | - |
PT012_RS03360 (PT012_03360) | 742268..742561 | - | 294 | WP_004085592.1 | putative addiction module antidote protein | Antitoxin |
PT012_RS03365 (PT012_03365) | 742564..742860 | - | 297 | WP_004085590.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PT012_RS03370 (PT012_03370) | 742963..744108 | + | 1146 | WP_027700633.1 | baseplate J/gp47 family protein | - |
PT012_RS03375 (PT012_03375) | 744105..744665 | + | 561 | WP_027700634.1 | DUF2612 domain-containing protein | - |
PT012_RS03380 (PT012_03380) | 744669..745913 | + | 1245 | WP_272819575.1 | phage tail protein | - |
PT012_RS03385 (PT012_03385) | 746017..746463 | - | 447 | WP_004084994.1 | hypothetical protein | - |
PT012_RS03390 (PT012_03390) | 746721..747689 | - | 969 | WP_004084992.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 701573..745913 | 44340 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11169.70 Da Isoelectric Point: 10.0610
>T272294 WP_004085590.1 NZ_CP117820:c742860-742564 [Xylella fastidiosa]
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQRRGDTIYLLLCGGDKG
SQARDIKTALHLSEQWSE
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQRRGDTIYLLLCGGDKG
SQARDIKTALHLSEQWSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|