Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 477571..478157 Replicon chromosome
Accession NZ_CP117820
Organism Xylella fastidiosa strain ICMP 8740

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag PT012_RS02055 Protein ID WP_004089517.1
Coordinates 477903..478157 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag PT012_RS02050 Protein ID WP_004085025.1
Coordinates 477571..477906 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT012_RS02020 (PT012_02020) 474345..474878 - 534 WP_051247998.1 terminase small subunit -
PT012_RS02025 (PT012_02025) 475051..475275 - 225 WP_027700448.1 hypothetical protein -
PT012_RS02030 (PT012_02030) 475277..475738 - 462 WP_140162026.1 hypothetical protein -
PT012_RS02035 (PT012_02035) 475728..476057 - 330 WP_004085022.1 phage holin family protein -
PT012_RS02040 (PT012_02040) 476050..476550 - 501 WP_234499714.1 lysozyme -
PT012_RS02045 (PT012_02045) 476650..477381 - 732 WP_272819592.1 site-specific DNA-methyltransferase -
PT012_RS02050 (PT012_02050) 477571..477906 - 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PT012_RS02055 (PT012_02055) 477903..478157 - 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
PT012_RS02060 (PT012_02060) 478237..478932 - 696 WP_272819593.1 hypothetical protein -
PT012_RS02065 (PT012_02065) 478875..479222 - 348 WP_160168467.1 hypothetical protein -
PT012_RS02070 (PT012_02070) 479411..480679 + 1269 WP_274169893.1 DNA polymerase -
PT012_RS02075 (PT012_02075) 480676..480954 + 279 WP_071869551.1 VRR-NUC domain-containing protein -
PT012_RS02080 (PT012_02080) 480956..481339 - 384 WP_027700081.1 hypothetical protein -
PT012_RS02085 (PT012_02085) 481424..482842 + 1419 WP_027700080.1 DEAD/DEAH box helicase -
PT012_RS02090 (PT012_02090) 482839..483003 + 165 WP_169709885.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 447794..486761 38967


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T272292 WP_004089517.1 NZ_CP117820:c478157-477903 [Xylella fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT272292 WP_004085025.1 NZ_CP117820:c477906-477571 [Xylella fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References