Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 19257..19855 | Replicon | plasmid unnamed |
| Accession | NZ_CP117816 | ||
| Organism | Legionella pneumophila strain D5573 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5WRX3 |
| Locus tag | PT256_RS00085 | Protein ID | WP_011212625.1 |
| Coordinates | 19658..19855 (-) | Length | 66 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5WRX4 |
| Locus tag | PT256_RS00080 | Protein ID | WP_011212624.1 |
| Coordinates | 19257..19661 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT256_RS00070 (PT256_00070) | 14925..15497 | - | 573 | WP_059411244.1 | recombinase family protein | - |
| PT256_RS00075 (PT256_00075) | 15633..18638 | + | 3006 | WP_059411246.1 | Tn3 family transposase | - |
| PT256_RS00080 (PT256_00080) | 19257..19661 | - | 405 | WP_011212624.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PT256_RS00085 (PT256_00085) | 19658..19855 | - | 198 | WP_011212625.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PT256_RS00090 (PT256_00090) | 20727..21590 | - | 864 | WP_052358007.1 | zincin-like metallopeptidase domain-containing protein | - |
| PT256_RS00095 (PT256_00095) | 21900..22061 | - | 162 | WP_011212628.1 | hypothetical protein | - |
| PT256_RS00100 (PT256_00100) | 22634..23167 | - | 534 | WP_011212629.1 | glyoxalase superfamily protein | - |
| PT256_RS00105 (PT256_00105) | 23747..24724 | + | 978 | WP_230305538.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..56207 | 56207 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 66 a.a. Molecular weight: 7403.75 Da Isoelectric Point: 10.6519
>T272286 WP_011212625.1 NZ_CP117816:c19855-19658 [Legionella pneumophila]
MKSAEIIKIIERDGWVQCHQKGSHCQFKHPTKKGRVTVPHPKKDLPIKTVASIFKQAGINKEDIK
MKSAEIIKIIERDGWVQCHQKGSHCQFKHPTKKGRVTVPHPKKDLPIKTVASIFKQAGINKEDIK
Download Length: 198 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 15006.00 Da Isoelectric Point: 4.5129
>AT272286 WP_011212624.1 NZ_CP117816:c19661-19257 [Legionella pneumophila]
MRYPVVIHKDEHSDFGVIVPDIPGCYSSGSTYDEALTNVIEAIECHLEGLLIDNEPLPVGTTIDRWINDEEFQGGVWAFV
DIDLSQISGKAKRINITMPERILSLIDLYAKNHAIKNRSSFLADAALSYMESHK
MRYPVVIHKDEHSDFGVIVPDIPGCYSSGSTYDEALTNVIEAIECHLEGLLIDNEPLPVGTTIDRWINDEEFQGGVWAFV
DIDLSQISGKAKRINITMPERILSLIDLYAKNHAIKNRSSFLADAALSYMESHK
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S0VJ23 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q5WRX4 |