Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1673092..1673620 | Replicon | chromosome |
| Accession | NZ_CP117812 | ||
| Organism | Lentisphaera profundi strain SAORIC-696 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PQO03_RS17865 | Protein ID | WP_274152244.1 |
| Coordinates | 1673092..1673379 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PQO03_RS17870 | Protein ID | WP_274152246.1 |
| Coordinates | 1673369..1673620 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQO03_RS17855 (PQO03_17855) | 1668188..1669600 | - | 1413 | WP_274152241.1 | DUF1501 domain-containing protein | - |
| PQO03_RS17860 (PQO03_17860) | 1669590..1672757 | - | 3168 | WP_274152242.1 | PSD1 and planctomycete cytochrome C domain-containing protein | - |
| PQO03_RS17865 (PQO03_17865) | 1673092..1673379 | - | 288 | WP_274152244.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQO03_RS17870 (PQO03_17870) | 1673369..1673620 | - | 252 | WP_274152246.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQO03_RS17875 (PQO03_17875) | 1673923..1675143 | - | 1221 | WP_274152247.1 | aldose 1-epimerase family protein | - |
| PQO03_RS17880 (PQO03_17880) | 1675159..1676010 | - | 852 | WP_274152249.1 | shikimate dehydrogenase | - |
| PQO03_RS17885 (PQO03_17885) | 1676022..1677302 | - | 1281 | WP_274152251.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11348.25 Da Isoelectric Point: 10.5941
>T272282 WP_274152244.1 NZ_CP117812:c1673379-1673092 [Lentisphaera profundi]
MSYDLSFLPSAKKEWDKLGHTIKEQFKKKLEKVLNEPRIEQNKLSGHSNLYKIKLRSSGYRLAYEVINNEMIIYVISVGK
RENNSIYKRMNRRLK
MSYDLSFLPSAKKEWDKLGHTIKEQFKKKLEKVLNEPRIEQNKLSGHSNLYKIKLRSSGYRLAYEVINNEMIIYVISVGK
RENNSIYKRMNRRLK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|