Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 1908609..1909080 Replicon chromosome
Accession NZ_CP117811
Organism Lentisphaera profundi strain SAORIC-696

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag PQO03_RS07595 Protein ID WP_274149248.1
Coordinates 1908609..1908869 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag PQO03_RS07600 Protein ID WP_274149250.1
Coordinates 1908859..1909080 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQO03_RS07550 (PQO03_07550) 1903793..1904062 + 270 WP_274149237.1 hypothetical protein -
PQO03_RS07555 (PQO03_07555) 1904139..1904744 + 606 WP_274149238.1 hypothetical protein -
PQO03_RS07560 (PQO03_07560) 1905286..1905765 + 480 WP_274149239.1 acyltransferase -
PQO03_RS07565 (PQO03_07565) 1905855..1906367 + 513 WP_274149240.1 hypothetical protein -
PQO03_RS07570 (PQO03_07570) 1906423..1906875 + 453 WP_274149241.1 hypothetical protein -
PQO03_RS07575 (PQO03_07575) 1906948..1907340 + 393 WP_274149243.1 DUF6334 family protein -
PQO03_RS07580 (PQO03_07580) 1907470..1907676 + 207 WP_274149244.1 type II toxin-antitoxin system VapB family antitoxin -
PQO03_RS07585 (PQO03_07585) 1907676..1908065 + 390 WP_274149226.1 PIN domain nuclease -
PQO03_RS07590 (PQO03_07590) 1908224..1908475 + 252 WP_274149246.1 hypothetical protein -
PQO03_RS07595 (PQO03_07595) 1908609..1908869 + 261 WP_274149248.1 BrnT family toxin Toxin
PQO03_RS07600 (PQO03_07600) 1908859..1909080 + 222 WP_274149250.1 hypothetical protein Antitoxin
PQO03_RS07605 (PQO03_07605) 1909231..1909422 + 192 WP_274149252.1 type II toxin-antitoxin system VapB family antitoxin -
PQO03_RS07610 (PQO03_07610) 1909422..1909802 + 381 WP_274149254.1 PIN domain-containing protein -
PQO03_RS07615 (PQO03_07615) 1910206..1910448 + 243 WP_274149256.1 type II toxin-antitoxin system ParD family antitoxin -
PQO03_RS07620 (PQO03_07620) 1910441..1910746 + 306 WP_274149258.1 type II toxin-antitoxin system RelE/ParE family toxin -
PQO03_RS07625 (PQO03_07625) 1910833..1911288 + 456 WP_274149259.1 hypothetical protein -
PQO03_RS07630 (PQO03_07630) 1911433..1911924 + 492 WP_274149261.1 hypothetical protein -
PQO03_RS07635 (PQO03_07635) 1912023..1912493 + 471 WP_274149263.1 hypothetical protein -
PQO03_RS07640 (PQO03_07640) 1912698..1912880 + 183 WP_274149264.1 hypothetical protein -
PQO03_RS07645 (PQO03_07645) 1912962..1913450 + 489 WP_274149266.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1873130..1958826 85696
- inside Integron - fcl 227..2808340 2808113


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(5-80)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10347.66 Da        Isoelectric Point: 8.3976

>T272279 WP_274149248.1 NZ_CP117811:1908609-1908869 [Lentisphaera profundi]
MNFEYDKNKSLSNKQKHNIDFVEAQQLWNDPDRLEIPGLTSDEPRYLIIGKIENKIWSAIITYRNNNIRIISVRRSREKE
VTYYES

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8555.82 Da        Isoelectric Point: 8.7012

>AT272279 WP_274149250.1 NZ_CP117811:1908859-1909080 [Lentisphaera profundi]
MKAKHFDKIFDDDNDDILAHVDLSKAKRPDEVQKRVNVDFPIWMIQSLDKEARRLGTTRQAVIKFWIADKLSS

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References