Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/GNAT-DUF1778 |
Location | 2391719..2392464 | Replicon | chromosome |
Accession | NZ_CP117798 | ||
Organism | Proteus mirabilis strain IVRI/FBI/326 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | PT008_RS11455 | Protein ID | WP_075673025.1 |
Coordinates | 2391973..2392464 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | PT008_RS11450 | Protein ID | WP_075673024.1 |
Coordinates | 2391719..2391985 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT008_RS11415 (PT008_11415) | 2387380..2387862 | + | 483 | WP_277697860.1 | flagellar basal body-associated protein FliL | - |
PT008_RS11420 (PT008_11420) | 2387868..2388899 | + | 1032 | WP_023581831.1 | flagellar motor switch protein FliM | - |
PT008_RS11425 (PT008_11425) | 2388892..2389302 | + | 411 | WP_023581830.1 | flagellar motor switch protein FliN | - |
PT008_RS11430 (PT008_11430) | 2389306..2389752 | + | 447 | WP_098942428.1 | flagellar biosynthetic protein FliO | - |
PT008_RS11435 (PT008_11435) | 2389752..2390522 | + | 771 | WP_277697861.1 | flagellar type III secretion system pore protein FliP | - |
PT008_RS11440 (PT008_11440) | 2390538..2390807 | + | 270 | WP_098942427.1 | flagellar biosynthesis protein FliQ | - |
PT008_RS11445 (PT008_11445) | 2390813..2391595 | + | 783 | WP_098942426.1 | flagellar biosynthetic protein FliR | - |
PT008_RS11450 (PT008_11450) | 2391719..2391985 | + | 267 | WP_075673024.1 | DUF1778 domain-containing protein | Antitoxin |
PT008_RS11455 (PT008_11455) | 2391973..2392464 | + | 492 | WP_075673025.1 | GNAT family N-acetyltransferase | Toxin |
PT008_RS11460 (PT008_11460) | 2392550..2393494 | - | 945 | WP_087802138.1 | flagellar hook-associated protein FlgL | - |
PT008_RS11465 (PT008_11465) | 2393519..2395162 | - | 1644 | WP_098942424.1 | flagellar hook-associated protein FlgK | - |
PT008_RS11470 (PT008_11470) | 2395281..2396267 | - | 987 | WP_099660621.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
PT008_RS11475 (PT008_11475) | 2396267..2397373 | - | 1107 | WP_098942422.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 18228.15 Da Isoelectric Point: 10.3194
>T272272 WP_075673025.1 NZ_CP117798:2391973-2392464 [Proteus mirabilis]
MGKVTAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFVVCEKNKKRVVGYYSLATGSVNHTEAMSHIRRNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKHFYLHHGFKASSTQDKILFLALK
KKI
MGKVTAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFVVCEKNKKRVVGYYSLATGSVNHTEAMSHIRRNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKHFYLHHGFKASSTQDKILFLALK
KKI
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|