Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 2481928..2482465 | Replicon | chromosome |
| Accession | NZ_CP117797 | ||
| Organism | Fusobacterium nucleatum strain FNA | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PSR68_RS11830 | Protein ID | WP_273904344.1 |
| Coordinates | 2481928..2482200 (-) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PSR68_RS11835 | Protein ID | WP_273904345.1 |
| Coordinates | 2482202..2482465 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSR68_RS11810 (PSR68_11810) | 2478654..2479901 | - | 1248 | WP_273904342.1 | Fic family protein | - |
| PSR68_RS11815 (PSR68_11815) | 2479997..2480551 | + | 555 | WP_273904343.1 | DUF1877 family protein | - |
| PSR68_RS11820 (PSR68_11820) | 2480548..2481237 | - | 690 | WP_005910338.1 | DUF554 domain-containing protein | - |
| PSR68_RS11825 (PSR68_11825) | 2481390..2481886 | + | 497 | Protein_2300 | AAA family ATPase | - |
| PSR68_RS11830 (PSR68_11830) | 2481928..2482200 | - | 273 | WP_273904344.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PSR68_RS11835 (PSR68_11835) | 2482202..2482465 | - | 264 | WP_273904345.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PSR68_RS11840 (PSR68_11840) | 2482541..2483047 | - | 507 | WP_273904347.1 | transcription repressor NadR | - |
| PSR68_RS11845 (PSR68_11845) | 2483040..2483900 | - | 861 | WP_273904348.1 | carboxylating nicotinate-nucleotide diphosphorylase | - |
| PSR68_RS11850 (PSR68_11850) | 2483878..2485170 | - | 1293 | WP_273904349.1 | L-aspartate oxidase | - |
| PSR68_RS11855 (PSR68_11855) | 2485172..2486068 | - | 897 | WP_273904350.1 | quinolinate synthase NadA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10671.46 Da Isoelectric Point: 8.7819
>T272271 WP_273904344.1 NZ_CP117797:c2482200-2481928 [Fusobacterium nucleatum]
MYEIKTTTKFEKDLKLMKKRGYDLKLLKEVIDILSNGEELSSKYKDHYLQGDYIGFKECHIKPDWLLVYKIDNNILVLTL
SRTGKHSDLF
MYEIKTTTKFEKDLKLMKKRGYDLKLLKEVIDILSNGEELSSKYKDHYLQGDYIGFKECHIKPDWLLVYKIDNNILVLTL
SRTGKHSDLF
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|