Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/PRK09907-MazE |
| Location | 311834..312405 | Replicon | chromosome |
| Accession | NZ_CP117797 | ||
| Organism | Fusobacterium nucleatum strain FNA | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PSR68_RS01520 | Protein ID | WP_273904759.1 |
| Coordinates | 312082..312405 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A140PUK7 |
| Locus tag | PSR68_RS01515 | Protein ID | WP_008701954.1 |
| Coordinates | 311834..312088 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSR68_RS01500 (PSR68_01500) | 307349..307768 | - | 420 | WP_005910583.1 | NfeD family protein | - |
| PSR68_RS01505 (PSR68_01505) | 308010..309479 | + | 1470 | WP_158411227.1 | N-acetylglucosamine-specific PTS transporter subunit IIBC | - |
| PSR68_RS01510 (PSR68_01510) | 309566..311632 | + | 2067 | WP_273904756.1 | elongation factor G | - |
| PSR68_RS01515 (PSR68_01515) | 311834..312088 | + | 255 | WP_008701954.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PSR68_RS01520 (PSR68_01520) | 312082..312405 | + | 324 | WP_273904759.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PSR68_RS01525 (PSR68_01525) | 312534..312818 | - | 285 | WP_005910587.1 | ferredoxin family protein | - |
| PSR68_RS01530 (PSR68_01530) | 312821..314116 | - | 1296 | WP_273904760.1 | FAD-dependent oxidoreductase | - |
| PSR68_RS01535 (PSR68_01535) | 314140..314835 | - | 696 | WP_273904762.1 | ubiquinone/menaquinone biosynthesis methyltransferase | - |
| PSR68_RS01540 (PSR68_01540) | 314837..315760 | - | 924 | WP_273904764.1 | prenyltransferase | - |
| PSR68_RS01545 (PSR68_01545) | 315757..316737 | - | 981 | WP_273904765.1 | polyprenyl synthetase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12410.48 Da Isoelectric Point: 6.7218
>T272270 WP_273904759.1 NZ_CP117797:312082-312405 [Fusobacterium nucleatum]
VVERGDIIIINFDPVKGHEQAGKRPALVISNEKFYRIFKLAVILPITNNTKDFPFHVLLDDRTNIKGAILCEHLRTVDLE
ERKYNKVEKLPENLLEEVLEKVSLIFQ
VVERGDIIIINFDPVKGHEQAGKRPALVISNEKFYRIFKLAVILPITNNTKDFPFHVLLDDRTNIKGAILCEHLRTVDLE
ERKYNKVEKLPENLLEEVLEKVSLIFQ
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|