Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2494976..2495670 | Replicon | chromosome |
| Accession | NZ_CP117782 | ||
| Organism | Burkholderia sp. FERM BP-3421 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | Bsp3421_RS27255 | Protein ID | WP_273999093.1 |
| Coordinates | 2495497..2495670 (-) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | Bsp3421_RS27250 | Protein ID | WP_273999092.1 |
| Coordinates | 2494976..2495398 (-) | Length | 141 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Bsp3421_RS27235 (Bsp3421_005447) | 2491903..2492190 | + | 288 | WP_252982326.1 | hypothetical protein | - |
| Bsp3421_RS27240 (Bsp3421_005448) | 2492400..2493923 | + | 1524 | WP_273999090.1 | threonine ammonia-lyase, biosynthetic | - |
| Bsp3421_RS27245 (Bsp3421_005449) | 2493938..2494762 | + | 825 | WP_273999091.1 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF | - |
| Bsp3421_RS27250 (Bsp3421_005450) | 2494976..2495398 | - | 423 | WP_273999092.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| Bsp3421_RS27255 (Bsp3421_005451) | 2495497..2495670 | - | 174 | WP_273999093.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| Bsp3421_RS27260 (Bsp3421_005452) | 2496181..2496567 | - | 387 | WP_273999095.1 | Rid family hydrolase | - |
| Bsp3421_RS27265 (Bsp3421_005453) | 2496655..2498124 | - | 1470 | WP_273999096.1 | D-aminoacylase | - |
| Bsp3421_RS27270 (Bsp3421_005454) | 2498126..2499019 | - | 894 | WP_273999097.1 | MurR/RpiR family transcriptional regulator | - |
| Bsp3421_RS27275 (Bsp3421_005455) | 2499139..2500506 | + | 1368 | WP_273999099.1 | amino acid deaminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6455.41 Da Isoelectric Point: 10.8118
>T272267 WP_273999093.1 NZ_CP117782:c2495670-2495497 [Burkholderia sp. FERM BP-3421]
VKFSEFRRWLVDRGATFEEGAKHAKVYLNGRQTTLPRHSGEIGEGLRRAICKQLGLA
VKFSEFRRWLVDRGATFEEGAKHAKVYLNGRQTTLPRHSGEIGEGLRRAICKQLGLA
Download Length: 174 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15553.94 Da Isoelectric Point: 4.6012
>AT272267 WP_273999092.1 NZ_CP117782:c2495398-2494976 [Burkholderia sp. FERM BP-3421]
MLRYPAKLERDGEGYVVTFRDIPEAITSGATKEEAWVMAEDALLTAMDFYIEDERVVPPPSGARRGEAFVELPASVSAKV
LLLNAMVDQSVRPFELAKRMGIRPQEVQRIMDLSHVTKIDTLEAAFAALGKRLEITAEAF
MLRYPAKLERDGEGYVVTFRDIPEAITSGATKEEAWVMAEDALLTAMDFYIEDERVVPPPSGARRGEAFVELPASVSAKV
LLLNAMVDQSVRPFELAKRMGIRPQEVQRIMDLSHVTKIDTLEAAFAALGKRLEITAEAF
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|