Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 141025..141575 | Replicon | plasmid p2 |
| Accession | NZ_CP117779 | ||
| Organism | Burkholderia sp. FERM BP-3421 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | Bsp3421_RS00650 | Protein ID | WP_273994925.1 |
| Coordinates | 141285..141575 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | Bsp3421_RS00645 | Protein ID | WP_273994924.1 |
| Coordinates | 141025..141297 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Bsp3421_RS00625 (Bsp3421_000125) | 136096..137088 | + | 993 | WP_273994920.1 | ATP-binding protein | - |
| Bsp3421_RS00630 (Bsp3421_000126) | 137085..138554 | + | 1470 | WP_273994921.1 | hypothetical protein | - |
| Bsp3421_RS00635 (Bsp3421_000127) | 138731..139363 | + | 633 | WP_273994922.1 | hypothetical protein | - |
| Bsp3421_RS00640 (Bsp3421_000128) | 139523..140269 | + | 747 | WP_273994923.1 | hypothetical protein | - |
| Bsp3421_RS00645 (Bsp3421_000129) | 141025..141297 | + | 273 | WP_273994924.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| Bsp3421_RS00650 (Bsp3421_000130) | 141285..141575 | + | 291 | WP_273994925.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| Bsp3421_RS00655 (Bsp3421_000131) | 141620..141805 | + | 186 | WP_273994927.1 | hypothetical protein | - |
| Bsp3421_RS00660 (Bsp3421_000132) | 141811..142053 | + | 243 | WP_273994928.1 | hypothetical protein | - |
| Bsp3421_RS00665 (Bsp3421_000133) | 142246..142884 | + | 639 | WP_273994929.1 | helix-turn-helix domain-containing protein | - |
| Bsp3421_RS00670 (Bsp3421_000134) | 142912..143190 | + | 279 | WP_273994930.1 | hypothetical protein | - |
| Bsp3421_RS00675 (Bsp3421_000135) | 143261..143464 | + | 204 | WP_273994932.1 | hypothetical protein | - |
| Bsp3421_RS00680 (Bsp3421_000136) | 143519..144307 | + | 789 | WP_273994934.1 | hypothetical protein | - |
| Bsp3421_RS00685 (Bsp3421_000137) | 144304..144597 | + | 294 | WP_273994935.1 | hypothetical protein | - |
| Bsp3421_RS00690 (Bsp3421_000138) | 144594..145004 | + | 411 | WP_273994936.1 | hypothetical protein | - |
| Bsp3421_RS00695 (Bsp3421_000139) | 145010..145384 | + | 375 | WP_273994937.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..238570 | 238570 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10916.53 Da Isoelectric Point: 7.2020
>T272263 WP_273994925.1 NZ_CP117779:141285-141575 [Burkholderia sp. FERM BP-3421]
VPQVIWTRNAARAVQRMHQFLAMKDPTAAQRAVKAIRAGVDVLIDQPRLGRPVDDLDVEFREWLIDFGDSGYVVLYRVDE
AGVVILTVRHQREAGY
VPQVIWTRNAARAVQRMHQFLAMKDPTAAQRAVKAIRAGVDVLIDQPRLGRPVDDLDVEFREWLIDFGDSGYVVLYRVDE
AGVVILTVRHQREAGY
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|