Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 2916855..2917477 Replicon chromosome
Accession NZ_CP117768
Organism Nostoc sp. UHCC 0926

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PQG02_RS13585 Protein ID WP_273769134.1
Coordinates 2916855..2917241 (-) Length 129 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PQG02_RS13590 Protein ID WP_273769135.1
Coordinates 2917238..2917477 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQG02_RS13545 (PQG02_13810) 2912159..2912332 - 174 WP_273769127.1 hypothetical protein -
PQG02_RS13550 (PQG02_13815) 2912454..2912831 + 378 WP_273769128.1 hypothetical protein -
PQG02_RS13555 (PQG02_13820) 2912845..2913300 - 456 WP_273769129.1 hypothetical protein -
PQG02_RS13560 (PQG02_13825) 2913448..2914092 + 645 WP_273769130.1 Uma2 family endonuclease -
PQG02_RS13565 (PQG02_13830) 2914307..2914789 + 483 WP_273769131.1 fatty acid desaturase -
PQG02_RS13570 (PQG02_13835) 2914802..2914924 + 123 WP_273769132.1 hypothetical protein -
PQG02_RS13575 (PQG02_13840) 2914955..2915272 + 318 WP_273769559.1 fatty acid desaturase -
PQG02_RS13580 (PQG02_13845) 2915400..2916659 + 1260 WP_273769133.1 bifunctional sterol desaturase/short chain dehydrogenase -
PQG02_RS13585 (PQG02_13850) 2916855..2917241 - 387 WP_273769134.1 type II toxin-antitoxin system VapC family toxin Toxin
PQG02_RS13590 (PQG02_13855) 2917238..2917477 - 240 WP_273769135.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PQG02_RS13595 (PQG02_13860) 2917716..2918051 - 336 WP_273769136.1 XisI protein -
PQG02_RS13600 (PQG02_13865) 2918343..2918672 - 330 WP_273769137.1 hypothetical protein -
PQG02_RS13605 (PQG02_13870) 2918739..2919101 - 363 WP_273769138.1 hypothetical protein -
PQG02_RS13610 (PQG02_13875) 2919127..2919456 - 330 WP_273769139.1 XisI protein -
PQG02_RS13615 (PQG02_13880) 2919444..2919860 - 417 WP_273769140.1 XisH family protein -
PQG02_RS13620 (PQG02_13885) 2919996..2921273 - 1278 WP_273769141.1 adenosylhomocysteinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-127)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-44)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14797.26 Da        Isoelectric Point: 6.4730

>T272262 WP_273769134.1 NZ_CP117768:c2917241-2916855 [Nostoc sp. UHCC 0926]
MKLLLDTHIFLWFISGDQKLPINLQNSIRDLNNDVYLSCVSVWEATVKYQLGKLPLPESPEIYLPKQRQQHLISSLNLDE
ESVAQLLKLPLLHRDPFDRMLICQALQHNLTILTVDPAIRSYSVSVLY

Download         Length: 387 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8606.86 Da        Isoelectric Point: 3.8431

>AT272262 WP_273769135.1 NZ_CP117768:c2917477-2917238 [Nostoc sp. UHCC 0926]
MLTVTIDEIQQNLTSYLQQVVAGESIIIMQAGKPIAEIKPVSATSQPIRPYGLCAGEFIVPDDFDSPLPEEILNSFEGK

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References