Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 2186064..2186717 | Replicon | chromosome |
Accession | NZ_CP117764 | ||
Organism | Acinetobacter baumannii strain 2022CK-00784 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PTC86_RS10295 | Protein ID | WP_000607077.1 |
Coordinates | 2186064..2186453 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | PTC86_RS10300 | Protein ID | WP_001288210.1 |
Coordinates | 2186460..2186717 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC86_RS10280 (PTC86_10280) | 2181182..2183377 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
PTC86_RS10285 (PTC86_10285) | 2183565..2184131 | - | 567 | WP_000651538.1 | rhombosortase | - |
PTC86_RS10290 (PTC86_10290) | 2184209..2185294 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
PTC86_RS10295 (PTC86_10295) | 2186064..2186453 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
PTC86_RS10300 (PTC86_10300) | 2186460..2186717 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PTC86_RS10305 (PTC86_10305) | 2186905..2188077 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
PTC86_RS10310 (PTC86_10310) | 2188126..2189616 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PTC86_RS10315 (PTC86_10315) | 2189798..2190175 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
PTC86_RS10320 (PTC86_10320) | 2190194..2191201 | - | 1008 | WP_273780449.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T272260 WP_000607077.1 NZ_CP117764:c2186453-2186064 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|