Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3313151..3313804 | Replicon | chromosome |
| Accession | NZ_CP117762 | ||
| Organism | Acinetobacter baumannii strain 2022CK-00839 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PTC93_RS16000 | Protein ID | WP_000607077.1 |
| Coordinates | 3313151..3313540 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | PTC93_RS16005 | Protein ID | WP_001288210.1 |
| Coordinates | 3313547..3313804 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC93_RS15985 (PTC93_15975) | 3308269..3310464 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
| PTC93_RS15990 (PTC93_15980) | 3310652..3311218 | - | 567 | WP_000651538.1 | rhombosortase | - |
| PTC93_RS15995 (PTC93_15985) | 3311296..3312381 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| PTC93_RS16000 (PTC93_15990) | 3313151..3313540 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
| PTC93_RS16005 (PTC93_15995) | 3313547..3313804 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| PTC93_RS16010 (PTC93_16000) | 3313992..3315164 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| PTC93_RS16015 (PTC93_16005) | 3315213..3316703 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| PTC93_RS16020 (PTC93_16010) | 3316885..3317262 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| PTC93_RS16025 (PTC93_16015) | 3317281..3318288 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T272258 WP_000607077.1 NZ_CP117762:c3313540-3313151 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|