Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 108332..108855 Replicon plasmid unnamed2
Accession NZ_CP117752
Organism Enterobacter hormaechei strain 2022CK-00700

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag PTC84_RS25745 Protein ID WP_015632464.1
Coordinates 108332..108637 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag PTC84_RS25750 Protein ID WP_015632465.1
Coordinates 108637..108855 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC84_RS25700 (PTC84_25700) 103362..103790 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
PTC84_RS25705 (PTC84_25705) 103783..104763 - 981 WP_015632457.1 plasmid segregation protein ParM -
PTC84_RS25710 (PTC84_25710) 105124..105306 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
PTC84_RS25715 (PTC84_25715) 105332..105775 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
PTC84_RS25720 (PTC84_25720) 105981..106103 - 123 Protein_112 transcriptional regulator -
PTC84_RS25725 (PTC84_25725) 106117..106344 - 228 WP_016162072.1 hypothetical protein -
PTC84_RS25730 (PTC84_25730) 106576..107031 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
PTC84_RS25735 (PTC84_25735) 107283..107378 - 96 Protein_115 IS1 family transposase -
PTC84_RS25740 (PTC84_25740) 107843..108220 - 378 WP_016162069.1 hypothetical protein -
PTC84_RS25745 (PTC84_25745) 108332..108637 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
PTC84_RS25750 (PTC84_25750) 108637..108855 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PTC84_RS25755 (PTC84_25755) 109041..110066 + 1026 WP_015632466.1 IS110 family transposase -
PTC84_RS25760 (PTC84_25760) 110361..110846 + 486 Protein_120 IS5 family transposase -
PTC84_RS25765 (PTC84_25765) 111010..111441 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
PTC84_RS25770 (PTC84_25770) 111441..112712 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 - 1..113105 113105


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T272255 WP_015632464.1 NZ_CP117752:c108637-108332 [Enterobacter hormaechei]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT272255 WP_015632465.1 NZ_CP117752:c108855-108637 [Enterobacter hormaechei]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References