Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 236214..236740 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117751 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00700 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | PTC84_RS24725 | Protein ID | WP_000323025.1 |
| Coordinates | 236214..236501 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PTC84_RS24730 | Protein ID | WP_000534858.1 |
| Coordinates | 236501..236740 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC84_RS24690 (PTC84_24690) | 231784..231960 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| PTC84_RS24695 (PTC84_24695) | 232471..233415 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| PTC84_RS24700 (PTC84_24700) | 233511..234113 | + | 603 | WP_012695474.1 | hypothetical protein | - |
| PTC84_RS24705 (PTC84_24705) | 234173..234523 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| PTC84_RS24710 (PTC84_24710) | 234570..234773 | + | 204 | WP_001015183.1 | hypothetical protein | - |
| PTC84_RS24715 (PTC84_24715) | 235055..235375 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| PTC84_RS24720 (PTC84_24720) | 235988..236113 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
| PTC84_RS24725 (PTC84_24725) | 236214..236501 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| PTC84_RS24730 (PTC84_24730) | 236501..236740 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PTC84_RS24735 (PTC84_24735) | 236765..236869 | + | 105 | Protein_243 | protein YdfV | - |
| PTC84_RS24740 (PTC84_24740) | 237003..237926 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| PTC84_RS24745 (PTC84_24745) | 238126..238698 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| PTC84_RS24750 (PTC84_24750) | 239174..240412 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA2 / qacE / sul1 / qnrB2 / dfrA19 / aph(3'')-Ib / aph(6)-Id / mcr-9 / aph(3')-Ia / sul2 / blaSHV-12 / catA2 | - | 1..310787 | 310787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T272254 WP_000323025.1 NZ_CP117751:c236501-236214 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|