Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4722091..4722667 | Replicon | chromosome |
| Accession | NZ_CP117750 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00700 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | PTC84_RS22845 | Protein ID | WP_015572580.1 |
| Coordinates | 4722091..4722378 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | PTC84_RS22850 | Protein ID | WP_017694570.1 |
| Coordinates | 4722365..4722667 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC84_RS22820 (PTC84_22820) | 4717208..4717903 | + | 696 | WP_045348386.1 | winged helix-turn-helix domain-containing protein | - |
| PTC84_RS22825 (PTC84_22825) | 4718053..4718523 | + | 471 | WP_015572576.1 | MarR family transcriptional regulator | - |
| PTC84_RS22830 (PTC84_22830) | 4718520..4719587 | + | 1068 | WP_026080654.1 | HlyD family secretion protein | - |
| PTC84_RS22835 (PTC84_22835) | 4719577..4720653 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| PTC84_RS22840 (PTC84_22840) | 4720650..4721921 | - | 1272 | WP_251993402.1 | DUF445 domain-containing protein | - |
| PTC84_RS22845 (PTC84_22845) | 4722091..4722378 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| PTC84_RS22850 (PTC84_22850) | 4722365..4722667 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| PTC84_RS22855 (PTC84_22855) | 4722696..4723334 | - | 639 | WP_273961638.1 | LysE family translocator | - |
| PTC84_RS22860 (PTC84_22860) | 4723373..4724125 | - | 753 | WP_045348389.1 | AraC family transcriptional regulator | - |
| PTC84_RS22865 (PTC84_22865) | 4724279..4725649 | + | 1371 | WP_015572583.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| PTC84_RS22870 (PTC84_22870) | 4725829..4726374 | - | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T272253 WP_015572580.1 NZ_CP117750:4722091-4722378 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|