Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 4409953..4410549 | Replicon | chromosome |
| Accession | NZ_CP117750 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00700 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PTC84_RS21355 | Protein ID | WP_023295756.1 |
| Coordinates | 4410247..4410549 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A927HL08 |
| Locus tag | PTC84_RS21350 | Protein ID | WP_023295755.1 |
| Coordinates | 4409953..4410240 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC84_RS21345 (PTC84_21345) | 4408325..4409956 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
| PTC84_RS21350 (PTC84_21350) | 4409953..4410240 | - | 288 | WP_023295755.1 | putative addiction module antidote protein | Antitoxin |
| PTC84_RS21355 (PTC84_21355) | 4410247..4410549 | - | 303 | WP_023295756.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTC84_RS21360 (PTC84_21360) | 4410747..4411619 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| PTC84_RS21365 (PTC84_21365) | 4411620..4411892 | - | 273 | WP_017382612.1 | DUF3811 domain-containing protein | - |
| PTC84_RS21370 (PTC84_21370) | 4411943..4412887 | - | 945 | WP_015570166.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| PTC84_RS21375 (PTC84_21375) | 4412981..4414330 | - | 1350 | WP_006810501.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11441.24 Da Isoelectric Point: 10.1042
>T272252 WP_023295756.1 NZ_CP117750:c4410549-4410247 [Enterobacter hormaechei]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|