Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4190085..4190804 Replicon chromosome
Accession NZ_CP117750
Organism Enterobacter hormaechei strain 2022CK-00700

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PTC84_RS20310 Protein ID WP_040117033.1
Coordinates 4190085..4190405 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PTC84_RS20315 Protein ID WP_032620726.1
Coordinates 4190439..4190804 (-) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC84_RS20275 (PTC84_20275) 4185352..4185717 - 366 WP_023302859.1 DUF2778 domain-containing protein -
PTC84_RS20280 (PTC84_20280) 4185727..4186212 - 486 WP_017383637.1 type VI secretion system tube protein TssD -
PTC84_RS20285 (PTC84_20285) 4186476..4187504 - 1029 WP_047726348.1 RhuM family protein -
PTC84_RS20290 (PTC84_20290) 4187563..4187904 - 342 WP_006812446.1 SymE family type I addiction module toxin -
PTC84_RS20295 (PTC84_20295) 4188029..4188220 + 192 WP_032634623.1 toxin-antitoxin system HicB family antitoxin -
PTC84_RS20300 (PTC84_20300) 4188234..4189070 - 837 WP_045348478.1 DUF6430 domain-containing protein -
PTC84_RS20305 (PTC84_20305) 4189123..4189683 - 561 WP_023315130.1 TIR domain-containing protein -
PTC84_RS20310 (PTC84_20310) 4190085..4190405 - 321 WP_040117033.1 TA system toxin CbtA family protein Toxin
PTC84_RS20315 (PTC84_20315) 4190439..4190804 - 366 WP_032620726.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PTC84_RS20320 (PTC84_20320) 4190836..4191057 - 222 WP_032620724.1 DUF987 domain-containing protein -
PTC84_RS20325 (PTC84_20325) 4191066..4191536 - 471 WP_040117034.1 DNA repair protein RadC -
PTC84_RS20330 (PTC84_20330) 4191606..4192427 - 822 WP_032620720.1 DUF932 domain-containing protein -
PTC84_RS20335 (PTC84_20335) 4192870..4193061 - 192 WP_023305181.1 hypothetical protein -
PTC84_RS20340 (PTC84_20340) 4193120..4193959 - 840 WP_049125417.1 hypothetical protein -
PTC84_RS20345 (PTC84_20345) 4194072..4194506 - 435 WP_044488933.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - hcp/tssD 4169811..4216825 47014
- inside Genomic island - - 4181850..4216825 34975


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(5-104)

Antitoxin

Antitoxin CbeA

(18-116)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12206.77 Da        Isoelectric Point: 5.9558

>T272251 WP_040117033.1 NZ_CP117750:c4190405-4190085 [Enterobacter hormaechei]
MHISTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVHRAQYNLGLKRS

Download         Length: 321 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13574.29 Da        Isoelectric Point: 6.4673

>AT272251 WP_032620726.1 NZ_CP117750:c4190804-4190439 [Enterobacter hormaechei]
MQSTTISGTSAENTSCLQWELKRNITPCFGARLVQESNRLYFLADRAGFNGSFSDDEALRLDQAFPLMMKQLERMLTAGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References