Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4002136..4002752 | Replicon | chromosome |
Accession | NZ_CP117750 | ||
Organism | Enterobacter hormaechei strain 2022CK-00700 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PTC84_RS19390 | Protein ID | WP_077266491.1 |
Coordinates | 4002136..4002507 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PTC84_RS19395 | Protein ID | WP_196278329.1 |
Coordinates | 4002510..4002752 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC84_RS19375 (PTC84_19375) | 3999636..4000538 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
PTC84_RS19380 (PTC84_19380) | 4000535..4001170 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
PTC84_RS19385 (PTC84_19385) | 4001167..4002096 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
PTC84_RS19390 (PTC84_19390) | 4002136..4002507 | - | 372 | WP_077266491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTC84_RS19395 (PTC84_19395) | 4002510..4002752 | - | 243 | WP_196278329.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PTC84_RS19400 (PTC84_19400) | 4002951..4003871 | + | 921 | WP_032652004.1 | alpha/beta hydrolase | - |
PTC84_RS19405 (PTC84_19405) | 4003880..4004821 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
PTC84_RS19410 (PTC84_19410) | 4004866..4005303 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
PTC84_RS19415 (PTC84_19415) | 4005300..4006181 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
PTC84_RS19420 (PTC84_19420) | 4006175..4006774 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
PTC84_RS19425 (PTC84_19425) | 4006893..4007693 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13723.85 Da Isoelectric Point: 6.4882
>T272248 WP_077266491.1 NZ_CP117750:c4002507-4002136 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|