Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1608137..1608876 | Replicon | chromosome |
| Accession | NZ_CP117750 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00700 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
| Locus tag | PTC84_RS07920 | Protein ID | WP_003857133.1 |
| Coordinates | 1608137..1608622 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | PTC84_RS07925 | Protein ID | WP_003857131.1 |
| Coordinates | 1608610..1608876 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC84_RS07890 (PTC84_07890) | 1603401..1604159 | + | 759 | WP_047637345.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PTC84_RS07895 (PTC84_07895) | 1604264..1605556 | + | 1293 | WP_196278053.1 | glycosyl hydrolase family 28 protein | - |
| PTC84_RS07900 (PTC84_07900) | 1605556..1606170 | + | 615 | WP_080300286.1 | NUDIX hydrolase | - |
| PTC84_RS07905 (PTC84_07905) | 1606354..1606989 | - | 636 | WP_273961765.1 | DUF421 domain-containing protein | - |
| PTC84_RS07910 (PTC84_07910) | 1606999..1607445 | - | 447 | WP_273961766.1 | DUF3290 domain-containing protein | - |
| PTC84_RS07915 (PTC84_07915) | 1607723..1607884 | - | 162 | Protein_1551 | ISNCY family transposase | - |
| PTC84_RS07920 (PTC84_07920) | 1608137..1608622 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
| PTC84_RS07925 (PTC84_07925) | 1608610..1608876 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| PTC84_RS07930 (PTC84_07930) | 1608940..1609869 | - | 930 | WP_059294931.1 | LysR family transcriptional regulator | - |
| PTC84_RS07935 (PTC84_07935) | 1609999..1611387 | + | 1389 | WP_059294932.1 | MFS transporter | - |
| PTC84_RS07940 (PTC84_07940) | 1611409..1612404 | - | 996 | WP_015570513.1 | DUF2891 domain-containing protein | - |
| PTC84_RS07945 (PTC84_07945) | 1612414..1613400 | - | 987 | WP_063863964.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1592977..1608876 | 15899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T272241 WP_003857133.1 NZ_CP117750:c1608622-1608137 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9PBP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |