Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 986076..986873 | Replicon | chromosome |
| Accession | NZ_CP117750 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00700 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | PTC84_RS04720 | Protein ID | WP_040117472.1 |
| Coordinates | 986352..986873 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | F5RT92 |
| Locus tag | PTC84_RS04715 | Protein ID | WP_001303459.1 |
| Coordinates | 986076..986345 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC84_RS04680 (PTC84_04680) | 981616..981975 | + | 360 | WP_017384779.1 | helix-turn-helix domain-containing protein | - |
| PTC84_RS04685 (PTC84_04685) | 982054..982149 | - | 96 | Protein_911 | transcriptional regulator | - |
| PTC84_RS04690 (PTC84_04690) | 982302..983543 | + | 1242 | WP_017693667.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
| PTC84_RS04695 (PTC84_04695) | 983576..983803 | - | 228 | WP_006809324.1 | YccJ family protein | - |
| PTC84_RS04700 (PTC84_04700) | 983822..984418 | - | 597 | WP_006809323.1 | NAD(P)H:quinone oxidoreductase | - |
| PTC84_RS04705 (PTC84_04705) | 984810..984980 | + | 171 | WP_001273664.1 | general stress protein | - |
| PTC84_RS04710 (PTC84_04710) | 985097..986002 | + | 906 | WP_017693666.1 | DMT family transporter | - |
| PTC84_RS04715 (PTC84_04715) | 986076..986345 | + | 270 | WP_001303459.1 | DUF1778 domain-containing protein | Antitoxin |
| PTC84_RS04720 (PTC84_04720) | 986352..986873 | + | 522 | WP_040117472.1 | GNAT family N-acetyltransferase | Toxin |
| PTC84_RS04725 (PTC84_04725) | 986932..988254 | - | 1323 | WP_196277966.1 | pyrimidine utilization transport protein G | - |
| PTC84_RS04730 (PTC84_04730) | 988276..988767 | - | 492 | WP_040117474.1 | pyrimidine utilization flavin reductase protein F | - |
| PTC84_RS04735 (PTC84_04735) | 988780..989370 | - | 591 | WP_040117475.1 | malonic semialdehyde reductase | - |
| PTC84_RS04740 (PTC84_04740) | 989380..990180 | - | 801 | WP_047735077.1 | pyrimidine utilization protein D | - |
| PTC84_RS04745 (PTC84_04745) | 990188..990574 | - | 387 | WP_040117477.1 | pyrimidine utilization protein C | - |
| PTC84_RS04750 (PTC84_04750) | 990586..991275 | - | 690 | WP_040117478.1 | pyrimidine utilization protein B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19437.18 Da Isoelectric Point: 7.4317
>T272240 WP_040117472.1 NZ_CP117750:986352-986873 [Enterobacter hormaechei]
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTDHLVRQHGGRILRGYLLKERDHPRILGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTDHLVRQHGGRILRGYLLKERDHPRILGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|