Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5433444..5434030 | Replicon | chromosome |
Accession | NZ_CP117749 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00828 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PTC91_RS25775 | Protein ID | WP_003120987.1 |
Coordinates | 5433731..5434030 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PTC91_RS25770 | Protein ID | WP_003448662.1 |
Coordinates | 5433444..5433734 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC91_RS25750 (PTC91_25750) | 5428595..5428804 | + | 210 | WP_003105733.1 | cold-shock protein | - |
PTC91_RS25755 (PTC91_25755) | 5429026..5430915 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
PTC91_RS25760 (PTC91_25760) | 5430912..5432888 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
PTC91_RS25765 (PTC91_25765) | 5433029..5433373 | + | 345 | WP_016851612.1 | hypothetical protein | - |
PTC91_RS25770 (PTC91_25770) | 5433444..5433734 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PTC91_RS25775 (PTC91_25775) | 5433731..5434030 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC91_RS25780 (PTC91_25780) | 5434232..5435356 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
PTC91_RS25785 (PTC91_25785) | 5435356..5437065 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
PTC91_RS25790 (PTC91_25790) | 5437069..5438394 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
PTC91_RS25795 (PTC91_25795) | 5438384..5438917 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5406465..5494545 | 88080 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T272236 WP_003120987.1 NZ_CP117749:c5434030-5433731 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|