Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5006734..5007342 | Replicon | chromosome |
Accession | NZ_CP117749 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00828 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | PTC91_RS23785 | Protein ID | WP_019486378.1 |
Coordinates | 5006734..5007081 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PTC91_RS23790 | Protein ID | WP_003114155.1 |
Coordinates | 5007091..5007342 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC91_RS23760 (PTC91_23760) | 5001796..5002128 | + | 333 | WP_003121550.1 | IS66 family insertion sequence element accessory protein TnpB | - |
PTC91_RS23765 (PTC91_23765) | 5002205..5003755 | + | 1551 | WP_151023681.1 | IS66 family transposase | - |
PTC91_RS23770 (PTC91_23770) | 5003778..5004197 | - | 420 | WP_151023680.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
PTC91_RS23775 (PTC91_23775) | 5004394..5005353 | + | 960 | WP_228846185.1 | cation transporter | - |
PTC91_RS23780 (PTC91_23780) | 5005516..5006424 | + | 909 | WP_003141085.1 | LysR family transcriptional regulator | - |
PTC91_RS23785 (PTC91_23785) | 5006734..5007081 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC91_RS23790 (PTC91_23790) | 5007091..5007342 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTC91_RS23795 (PTC91_23795) | 5007556..5008539 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
PTC91_RS23800 (PTC91_23800) | 5008539..5009831 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
PTC91_RS23805 (PTC91_23805) | 5010090..5011352 | - | 1263 | WP_019486376.1 | zonular occludens toxin domain-containing protein | - |
PTC91_RS23810 (PTC91_23810) | 5011354..5011704 | - | 351 | WP_003133726.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4879877..5047579 | 167702 | |
- | flank | IS/Tn | - | - | 5001766..5002128 | 362 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T272235 WP_019486378.1 NZ_CP117749:c5007081-5006734 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |