Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2699469..2700511 Replicon chromosome
Accession NZ_CP117749
Organism Pseudomonas aeruginosa strain 2022CK-00828

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PTC91_RS12920 Protein ID WP_003153636.1
Coordinates 2699936..2700511 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PTC91_RS12915 Protein ID WP_003050245.1
Coordinates 2699469..2699939 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC91_RS12880 (PTC91_12880) 2694861..2696279 - 1419 WP_006226029.1 TIGR03752 family integrating conjugative element protein -
PTC91_RS12885 (PTC91_12885) 2696269..2697180 - 912 WP_006226028.1 TIGR03749 family integrating conjugative element protein -
PTC91_RS12890 (PTC91_12890) 2697177..2697869 - 693 WP_003090182.1 TIGR03746 family integrating conjugative element protein -
PTC91_RS12895 (PTC91_12895) 2697866..2698264 - 399 WP_003050133.1 TIGR03750 family conjugal transfer protein -
PTC91_RS12900 (PTC91_12900) 2698276..2698635 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
PTC91_RS12905 (PTC91_12905) 2698652..2698885 - 234 WP_003090170.1 TIGR03758 family integrating conjugative element protein -
PTC91_RS12910 (PTC91_12910) 2698882..2699265 - 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
PTC91_RS12915 (PTC91_12915) 2699469..2699939 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PTC91_RS12920 (PTC91_12920) 2699936..2700511 + 576 WP_003153636.1 PIN domain-containing protein Toxin
PTC91_RS12925 (PTC91_12925) 2700508..2701443 + 936 WP_033970552.1 AAA family ATPase -
PTC91_RS12930 (PTC91_12930) 2701440..2701910 + 471 WP_003090160.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PTC91_RS12935 (PTC91_12935) 2701907..2702407 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PTC91_RS12940 (PTC91_12940) 2702407..2703309 + 903 WP_003090158.1 CBASS oligonucleotide cyclase -
PTC91_RS12945 (PTC91_12945) 2703348..2704073 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2624898..2753804 128906


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T272232 WP_003153636.1 NZ_CP117749:2699936-2700511 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT272232 WP_003050245.1 NZ_CP117749:2699469-2699939 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References