Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2699469..2700511 | Replicon | chromosome |
Accession | NZ_CP117749 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00828 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PTC91_RS12920 | Protein ID | WP_003153636.1 |
Coordinates | 2699936..2700511 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PTC91_RS12915 | Protein ID | WP_003050245.1 |
Coordinates | 2699469..2699939 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC91_RS12880 (PTC91_12880) | 2694861..2696279 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PTC91_RS12885 (PTC91_12885) | 2696269..2697180 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PTC91_RS12890 (PTC91_12890) | 2697177..2697869 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PTC91_RS12895 (PTC91_12895) | 2697866..2698264 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PTC91_RS12900 (PTC91_12900) | 2698276..2698635 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PTC91_RS12905 (PTC91_12905) | 2698652..2698885 | - | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
PTC91_RS12910 (PTC91_12910) | 2698882..2699265 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PTC91_RS12915 (PTC91_12915) | 2699469..2699939 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PTC91_RS12920 (PTC91_12920) | 2699936..2700511 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PTC91_RS12925 (PTC91_12925) | 2700508..2701443 | + | 936 | WP_033970552.1 | AAA family ATPase | - |
PTC91_RS12930 (PTC91_12930) | 2701440..2701910 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PTC91_RS12935 (PTC91_12935) | 2701907..2702407 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PTC91_RS12940 (PTC91_12940) | 2702407..2703309 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PTC91_RS12945 (PTC91_12945) | 2703348..2704073 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2624898..2753804 | 128906 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T272232 WP_003153636.1 NZ_CP117749:2699936-2700511 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT272232 WP_003050245.1 NZ_CP117749:2699469-2699939 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|