Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 150986..151491 | Replicon | chromosome |
Accession | NZ_CP117749 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00828 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PTC91_RS00705 | Protein ID | WP_003083773.1 |
Coordinates | 150986..151267 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PTC91_RS00710 | Protein ID | WP_003083775.1 |
Coordinates | 151264..151491 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC91_RS00680 (PTC91_00680) | 146237..147586 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
PTC91_RS00685 (PTC91_00685) | 147635..148321 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PTC91_RS00690 (PTC91_00690) | 148422..149156 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
PTC91_RS00695 (PTC91_00695) | 149336..149746 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
PTC91_RS00700 (PTC91_00700) | 149778..150686 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PTC91_RS00705 (PTC91_00705) | 150986..151267 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PTC91_RS00710 (PTC91_00710) | 151264..151491 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PTC91_RS00715 (PTC91_00715) | 151667..152290 | - | 624 | WP_003137011.1 | hypothetical protein | - |
PTC91_RS00720 (PTC91_00720) | 152391..152891 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PTC91_RS00725 (PTC91_00725) | 152963..153304 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PTC91_RS00730 (PTC91_00730) | 153386..154813 | - | 1428 | WP_003083784.1 | GABA permease | - |
PTC91_RS00735 (PTC91_00735) | 154982..156475 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T272230 WP_003083773.1 NZ_CP117749:c151267-150986 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|