Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 317908..318578 Replicon plasmid unnamed1
Accession NZ_CP117746
Organism Klebsiella pneumoniae strain 2022CK-00752

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag PTC85_RS28210 Protein ID WP_004213072.1
Coordinates 317908..318351 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag PTC85_RS28215 Protein ID WP_004213073.1
Coordinates 318348..318578 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC85_RS28175 (PTC85_28175) 313315..313590 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
PTC85_RS28180 (PTC85_28180) 313653..314144 + 492 WP_011251327.1 DM13 domain-containing protein -
PTC85_RS28185 (PTC85_28185) 314193..315113 + 921 WP_004213934.1 DUF1471 domain-containing protein -
PTC85_RS28190 (PTC85_28190) 315204..315607 + 404 Protein_334 GAF domain-containing protein -
PTC85_RS28195 (PTC85_28195) 316126..316764 - 639 Protein_335 mucoid phenotype regulator RmpA2 -
PTC85_RS28200 (PTC85_28200) 317181..317485 + 305 Protein_336 transposase -
PTC85_RS28205 (PTC85_28205) 317508..317759 - 252 WP_186987481.1 hypothetical protein -
PTC85_RS28210 (PTC85_28210) 317908..318351 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
PTC85_RS28215 (PTC85_28215) 318348..318578 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PTC85_RS28220 (PTC85_28220) 319186..320319 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
PTC85_RS28225 (PTC85_28225) 320335..320628 + 294 WP_004213076.1 hypothetical protein -
PTC85_RS28230 (PTC85_28230) 320618..320824 - 207 WP_004213077.1 hypothetical protein -
PTC85_RS28235 (PTC85_28235) 321176..321466 + 291 WP_004213078.1 hypothetical protein -
PTC85_RS28240 (PTC85_28240) 321456..322355 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaNDM-5 / aph(3')-VI / qnrS1 / blaCTX-M-15 / mph(A) / sul1 / qacE / dfrA5 iucA / iucB / iucC / iucD / iutA / rmpA2 1..381441 381441


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T272229 WP_004213072.1 NZ_CP117746:c318351-317908 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT272229 WP_004213073.1 NZ_CP117746:c318578-318348 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References