Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4846353..4846869 | Replicon | chromosome |
Accession | NZ_CP117745 | ||
Organism | Klebsiella pneumoniae strain 2022CK-00752 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | PTC85_RS23765 | Protein ID | WP_009486548.1 |
Coordinates | 4846353..4846637 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | PTC85_RS23770 | Protein ID | WP_002886901.1 |
Coordinates | 4846627..4846869 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC85_RS23740 (4841770) | 4841770..4842033 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
PTC85_RS23745 (4842163) | 4842163..4842336 | + | 174 | WP_032433782.1 | hypothetical protein | - |
PTC85_RS23750 (4842339) | 4842339..4843082 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
PTC85_RS23755 (4843439) | 4843439..4845577 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PTC85_RS23760 (4845885) | 4845885..4846349 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PTC85_RS23765 (4846353) | 4846353..4846637 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC85_RS23770 (4846627) | 4846627..4846869 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PTC85_RS23775 (4846947) | 4846947..4848857 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
PTC85_RS23780 (4848880) | 4848880..4850034 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
PTC85_RS23785 (4850101) | 4850101..4850841 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T272224 WP_009486548.1 NZ_CP117745:c4846637-4846353 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |