Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4736366..4737176 | Replicon | chromosome |
Accession | NZ_CP117745 | ||
Organism | Klebsiella pneumoniae strain 2022CK-00752 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A0H3GMP0 |
Locus tag | PTC85_RS23290 | Protein ID | WP_002887280.1 |
Coordinates | 4736366..4736899 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | PTC85_RS23295 | Protein ID | WP_002887278.1 |
Coordinates | 4736910..4737176 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC85_RS23285 (4735198) | 4735198..4736319 | + | 1122 | WP_009309849.1 | cupin domain-containing protein | - |
PTC85_RS23290 (4736366) | 4736366..4736899 | - | 534 | WP_002887280.1 | type II toxin-antitoxin system toxin KacT | Toxin |
PTC85_RS23295 (4736910) | 4736910..4737176 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
PTC85_RS23300 (4737279) | 4737279..4738712 | - | 1434 | WP_023288193.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
PTC85_RS23305 (4738702) | 4738702..4739385 | - | 684 | WP_032105399.1 | copper response regulator transcription factor CusR | - |
PTC85_RS23310 (4739558) | 4739558..4740943 | + | 1386 | WP_032431458.1 | efflux transporter outer membrane subunit | - |
PTC85_RS23315 (4740961) | 4740961..4741266 | + | 306 | WP_032432083.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19838.70 Da Isoelectric Point: 5.2614
>T272223 WP_002887280.1 NZ_CP117745:c4736899-4736366 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
PDB | 5XUN |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLZ1 |