Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4108532..4109151 Replicon chromosome
Accession NZ_CP117745
Organism Klebsiella pneumoniae strain 2022CK-00752

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PTC85_RS20290 Protein ID WP_002892050.1
Coordinates 4108933..4109151 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PTC85_RS20285 Protein ID WP_002892066.1
Coordinates 4108532..4108906 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC85_RS20275 (4103684) 4103684..4104877 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PTC85_RS20280 (4104900) 4104900..4108046 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PTC85_RS20285 (4108532) 4108532..4108906 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PTC85_RS20290 (4108933) 4108933..4109151 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PTC85_RS20295 (4109314) 4109314..4109880 + 567 WP_002892030.1 maltose O-acetyltransferase -
PTC85_RS20300 (4109852) 4109852..4109992 - 141 WP_004147370.1 hypothetical protein -
PTC85_RS20305 (4110013) 4110013..4110483 + 471 WP_020802585.1 YlaC family protein -
PTC85_RS20310 (4110458) 4110458..4111909 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
PTC85_RS20315 (4112010) 4112010..4112708 + 699 WP_023287311.1 GNAT family protein -
PTC85_RS20320 (4112705) 4112705..4112845 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PTC85_RS20325 (4112845) 4112845..4113108 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T272222 WP_002892050.1 NZ_CP117745:4108933-4109151 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT272222 WP_002892066.1 NZ_CP117745:4108532-4108906 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References