Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1472604..1473340 | Replicon | chromosome |
Accession | NZ_CP117745 | ||
Organism | Klebsiella pneumoniae strain 2022CK-00752 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | PTC85_RS07280 | Protein ID | WP_032433360.1 |
Coordinates | 1472858..1473340 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | PTC85_RS07275 | Protein ID | WP_003026799.1 |
Coordinates | 1472604..1472870 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC85_RS07250 (1468250) | 1468250..1469389 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
PTC85_RS07255 (1469418) | 1469418..1470080 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
PTC85_RS07260 (1470064) | 1470064..1471068 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
PTC85_RS07265 (1471086) | 1471086..1471718 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
PTC85_RS07270 (1471728) | 1471728..1472291 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
PTC85_RS07275 (1472604) | 1472604..1472870 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
PTC85_RS07280 (1472858) | 1472858..1473340 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
PTC85_RS07285 (1473540) | 1473540..1474943 | + | 1404 | WP_001272054.1 | ISNCY-like element ISKpn21 family transposase | - |
PTC85_RS07290 (1474972) | 1474972..1475604 | - | 633 | WP_001567369.1 | hypothetical protein | - |
PTC85_RS07295 (1475984) | 1475984..1476583 | - | 600 | WP_064472304.1 | helix-turn-helix transcriptional regulator | - |
PTC85_RS07300 (1476796) | 1476796..1477740 | - | 945 | WP_077254249.1 | fimbrial protein | - |
PTC85_RS07305 (1477752) | 1477752..1478330 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1440549..1486566 | 46017 | |
- | flank | IS/Tn | - | - | 1473540..1474943 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T272216 WP_032433360.1 NZ_CP117745:1472858-1473340 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |