Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1455913..1456556 | Replicon | chromosome |
| Accession | NZ_CP117745 | ||
| Organism | Klebsiella pneumoniae strain 2022CK-00752 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | PTC85_RS07185 | Protein ID | WP_032433387.1 |
| Coordinates | 1456140..1456556 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | PTC85_RS07180 | Protein ID | WP_004213073.1 |
| Coordinates | 1455913..1456143 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC85_RS07165 (1450935) | 1450935..1452022 | + | 1088 | Protein_1398 | transcriptional repressor PifC | - |
| PTC85_RS07170 (1452025) | 1452025..1454265 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| PTC85_RS07175 (1454793) | 1454793..1455608 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| PTC85_RS07180 (1455913) | 1455913..1456143 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PTC85_RS07185 (1456140) | 1456140..1456556 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PTC85_RS07190 (1456712) | 1456712..1457692 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| PTC85_RS07195 (1457887) | 1457887..1459458 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| PTC85_RS07200 (1459777) | 1459777..1460025 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| PTC85_RS07205 (1460084) | 1460084..1460602 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| PTC85_RS07210 (1460633) | 1460633..1461124 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| PTC85_RS07215 (1461184) | 1461184..1461387 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1440549..1486566 | 46017 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T272215 WP_032433387.1 NZ_CP117745:1456140-1456556 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q6U620 |