Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 277927..278597 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117741 | ||
| Organism | Klebsiella pneumoniae strain 2022CK-00768 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | PTC88_RS27980 | Protein ID | WP_004213072.1 |
| Coordinates | 277927..278370 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | PTC88_RS27985 | Protein ID | WP_004213073.1 |
| Coordinates | 278367..278597 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC88_RS27945 (PTC88_27945) | 273335..273610 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| PTC88_RS27950 (PTC88_27950) | 273673..274164 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| PTC88_RS27955 (PTC88_27955) | 274213..275133 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| PTC88_RS27960 (PTC88_27960) | 275224..275627 | + | 404 | Protein_293 | GAF domain-containing protein | - |
| PTC88_RS27965 (PTC88_27965) | 276146..276783 | - | 638 | Protein_294 | mucoid phenotype regulator RmpA2 | - |
| PTC88_RS27970 (PTC88_27970) | 277200..277504 | + | 305 | Protein_295 | transposase | - |
| PTC88_RS27975 (PTC88_27975) | 277527..277778 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| PTC88_RS27980 (PTC88_27980) | 277927..278370 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PTC88_RS27985 (PTC88_27985) | 278367..278597 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PTC88_RS27990 (PTC88_27990) | 279205..280338 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| PTC88_RS27995 (PTC88_27995) | 280354..280647 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| PTC88_RS28000 (PTC88_28000) | 280637..280843 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| PTC88_RS28005 (PTC88_28005) | 281195..281485 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| PTC88_RS28010 (PTC88_28010) | 281475..282374 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-5 / aph(3')-VI / qnrS1 / blaCTX-M-15 / mph(A) / sul1 / qacE / dfrA5 | iucA / iucB / iucC / iucD / iutA / rmpA | 1..341460 | 341460 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T272211 WP_004213072.1 NZ_CP117741:c278370-277927 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|