Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 277927..278597 Replicon plasmid unnamed1
Accession NZ_CP117741
Organism Klebsiella pneumoniae strain 2022CK-00768

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag PTC88_RS27980 Protein ID WP_004213072.1
Coordinates 277927..278370 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag PTC88_RS27985 Protein ID WP_004213073.1
Coordinates 278367..278597 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC88_RS27945 (PTC88_27945) 273335..273610 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
PTC88_RS27950 (PTC88_27950) 273673..274164 + 492 WP_011251327.1 DM13 domain-containing protein -
PTC88_RS27955 (PTC88_27955) 274213..275133 + 921 WP_004213934.1 DUF1471 domain-containing protein -
PTC88_RS27960 (PTC88_27960) 275224..275627 + 404 Protein_293 GAF domain-containing protein -
PTC88_RS27965 (PTC88_27965) 276146..276783 - 638 Protein_294 mucoid phenotype regulator RmpA2 -
PTC88_RS27970 (PTC88_27970) 277200..277504 + 305 Protein_295 transposase -
PTC88_RS27975 (PTC88_27975) 277527..277778 - 252 WP_186987481.1 hypothetical protein -
PTC88_RS27980 (PTC88_27980) 277927..278370 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
PTC88_RS27985 (PTC88_27985) 278367..278597 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PTC88_RS27990 (PTC88_27990) 279205..280338 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
PTC88_RS27995 (PTC88_27995) 280354..280647 + 294 WP_004213076.1 hypothetical protein -
PTC88_RS28000 (PTC88_28000) 280637..280843 - 207 WP_004213077.1 hypothetical protein -
PTC88_RS28005 (PTC88_28005) 281195..281485 + 291 WP_004213078.1 hypothetical protein -
PTC88_RS28010 (PTC88_28010) 281475..282374 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-5 / aph(3')-VI / qnrS1 / blaCTX-M-15 / mph(A) / sul1 / qacE / dfrA5 iucA / iucB / iucC / iucD / iutA / rmpA 1..341460 341460


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T272211 WP_004213072.1 NZ_CP117741:c278370-277927 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT272211 WP_004213073.1 NZ_CP117741:c278597-278367 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References