Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5322189..5322814 | Replicon | chromosome |
| Accession | NZ_CP117740 | ||
| Organism | Klebsiella pneumoniae strain 2022CK-00768 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | PTC88_RS26065 | Protein ID | WP_002882817.1 |
| Coordinates | 5322189..5322572 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | PTC88_RS26070 | Protein ID | WP_004150355.1 |
| Coordinates | 5322572..5322814 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC88_RS26050 (5319555) | 5319555..5320457 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| PTC88_RS26055 (5320454) | 5320454..5321089 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PTC88_RS26060 (5321086) | 5321086..5322015 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| PTC88_RS26065 (5322189) | 5322189..5322572 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PTC88_RS26070 (5322572) | 5322572..5322814 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| PTC88_RS26075 (5323019) | 5323019..5323936 | + | 918 | WP_021466676.1 | alpha/beta hydrolase | - |
| PTC88_RS26080 (5323950) | 5323950..5324891 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| PTC88_RS26085 (5324936) | 5324936..5325373 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| PTC88_RS26090 (5325370) | 5325370..5326230 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| PTC88_RS26095 (5326224) | 5326224..5326823 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T272208 WP_002882817.1 NZ_CP117740:c5322572-5322189 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |