Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4838152..4838668 | Replicon | chromosome |
| Accession | NZ_CP117740 | ||
| Organism | Klebsiella pneumoniae strain 2022CK-00768 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A2BGN7 |
| Locus tag | PTC88_RS23740 | Protein ID | WP_009486548.1 |
| Coordinates | 4838152..4838436 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | PTC88_RS23745 | Protein ID | WP_002886901.1 |
| Coordinates | 4838426..4838668 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC88_RS23715 (4833569) | 4833569..4833832 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| PTC88_RS23720 (4833962) | 4833962..4834135 | + | 174 | WP_032433782.1 | hypothetical protein | - |
| PTC88_RS23725 (4834138) | 4834138..4834881 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| PTC88_RS23730 (4835238) | 4835238..4837376 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PTC88_RS23735 (4837684) | 4837684..4838148 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PTC88_RS23740 (4838152) | 4838152..4838436 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PTC88_RS23745 (4838426) | 4838426..4838668 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PTC88_RS23750 (4838746) | 4838746..4840656 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| PTC88_RS23755 (4840679) | 4840679..4841833 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| PTC88_RS23760 (4841900) | 4841900..4842640 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T272206 WP_009486548.1 NZ_CP117740:c4838436-4838152 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A2BGN7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |