Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4100331..4100950 | Replicon | chromosome |
| Accession | NZ_CP117740 | ||
| Organism | Klebsiella pneumoniae strain 2022CK-00768 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | PTC88_RS20265 | Protein ID | WP_002892050.1 |
| Coordinates | 4100732..4100950 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | PTC88_RS20260 | Protein ID | WP_002892066.1 |
| Coordinates | 4100331..4100705 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC88_RS20250 (4095483) | 4095483..4096676 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PTC88_RS20255 (4096699) | 4096699..4099845 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PTC88_RS20260 (4100331) | 4100331..4100705 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| PTC88_RS20265 (4100732) | 4100732..4100950 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| PTC88_RS20270 (4101113) | 4101113..4101679 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| PTC88_RS20275 (4101651) | 4101651..4101791 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| PTC88_RS20280 (4101812) | 4101812..4102282 | + | 471 | WP_020802585.1 | YlaC family protein | - |
| PTC88_RS20285 (4102257) | 4102257..4103708 | - | 1452 | WP_004183206.1 | PLP-dependent aminotransferase family protein | - |
| PTC88_RS20290 (4103809) | 4103809..4104507 | + | 699 | WP_023287311.1 | GNAT family protein | - |
| PTC88_RS20295 (4104504) | 4104504..4104644 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| PTC88_RS20300 (4104644) | 4104644..4104907 | - | 264 | WP_032432663.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T272204 WP_002892050.1 NZ_CP117740:4100732-4100950 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT272204 WP_002892066.1 NZ_CP117740:4100331-4100705 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |