Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4100331..4100950 Replicon chromosome
Accession NZ_CP117740
Organism Klebsiella pneumoniae strain 2022CK-00768

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PTC88_RS20265 Protein ID WP_002892050.1
Coordinates 4100732..4100950 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PTC88_RS20260 Protein ID WP_002892066.1
Coordinates 4100331..4100705 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC88_RS20250 (4095483) 4095483..4096676 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PTC88_RS20255 (4096699) 4096699..4099845 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PTC88_RS20260 (4100331) 4100331..4100705 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PTC88_RS20265 (4100732) 4100732..4100950 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PTC88_RS20270 (4101113) 4101113..4101679 + 567 WP_002892030.1 maltose O-acetyltransferase -
PTC88_RS20275 (4101651) 4101651..4101791 - 141 WP_004147370.1 hypothetical protein -
PTC88_RS20280 (4101812) 4101812..4102282 + 471 WP_020802585.1 YlaC family protein -
PTC88_RS20285 (4102257) 4102257..4103708 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
PTC88_RS20290 (4103809) 4103809..4104507 + 699 WP_023287311.1 GNAT family protein -
PTC88_RS20295 (4104504) 4104504..4104644 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PTC88_RS20300 (4104644) 4104644..4104907 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T272204 WP_002892050.1 NZ_CP117740:4100732-4100950 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT272204 WP_002892066.1 NZ_CP117740:4100331-4100705 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References