Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1452855..1453498 | Replicon | chromosome |
Accession | NZ_CP117740 | ||
Organism | Klebsiella pneumoniae strain 2022CK-00768 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | PTC88_RS07180 | Protein ID | WP_032433387.1 |
Coordinates | 1453082..1453498 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | PTC88_RS07175 | Protein ID | WP_001261276.1 |
Coordinates | 1452855..1453085 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC88_RS07160 (1447877) | 1447877..1448964 | + | 1088 | Protein_1397 | transcriptional repressor PifC | - |
PTC88_RS07165 (1448967) | 1448967..1451207 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
PTC88_RS07170 (1451735) | 1451735..1452550 | - | 816 | WP_032433388.1 | hypothetical protein | - |
PTC88_RS07175 (1452855) | 1452855..1453085 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PTC88_RS07180 (1453082) | 1453082..1453498 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTC88_RS07185 (1453654) | 1453654..1454634 | + | 981 | WP_032433385.1 | hypothetical protein | - |
PTC88_RS07190 (1454829) | 1454829..1456400 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
PTC88_RS07195 (1456719) | 1456719..1456967 | + | 249 | WP_032433382.1 | hypothetical protein | - |
PTC88_RS07200 (1457026) | 1457026..1457544 | + | 519 | WP_045326794.1 | hypothetical protein | - |
PTC88_RS07205 (1457575) | 1457575..1458066 | + | 492 | WP_032433378.1 | hypothetical protein | - |
PTC88_RS07210 (1458126) | 1458126..1458329 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1437491..1483508 | 46017 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T272197 WP_032433387.1 NZ_CP117740:1453082-1453498 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |