Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 835626..836283 | Replicon | chromosome |
Accession | NZ_CP117740 | ||
Organism | Klebsiella pneumoniae strain 2022CK-00768 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | PTC88_RS04195 | Protein ID | WP_002916310.1 |
Coordinates | 835873..836283 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | PTC88_RS04190 | Protein ID | WP_002916312.1 |
Coordinates | 835626..835892 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC88_RS04165 (830782) | 830782..832215 | - | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
PTC88_RS04170 (832334) | 832334..833062 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
PTC88_RS04175 (833112) | 833112..833423 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
PTC88_RS04180 (833587) | 833587..834246 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
PTC88_RS04185 (834397) | 834397..835380 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
PTC88_RS04190 (835626) | 835626..835892 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
PTC88_RS04195 (835873) | 835873..836283 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
PTC88_RS04200 (836290) | 836290..836811 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
PTC88_RS04205 (836912) | 836912..837808 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
PTC88_RS04210 (837831) | 837831..838544 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PTC88_RS04215 (838550) | 838550..840283 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T272196 WP_002916310.1 NZ_CP117740:835873-836283 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |