Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-YefM |
Location | 156979..157550 | Replicon | plasmid unnamed2 |
Accession | NZ_CP117732 | ||
Organism | Klebsiella grimontii strain 2022CK-00781 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A2I8S8S5 |
Locus tag | PTC90_RS30510 | Protein ID | WP_011918375.1 |
Coordinates | 156979..157290 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1Z3MW28 |
Locus tag | PTC90_RS30515 | Protein ID | WP_011787805.1 |
Coordinates | 157290..157550 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC90_RS30500 (PTC90_30495) | 152976..153827 | + | 852 | WP_273863395.1 | 3'-5' exonuclease | - |
PTC90_RS30505 (PTC90_30500) | 153875..156955 | - | 3081 | WP_011787830.1 | Tn3 family transposase | - |
PTC90_RS30510 (PTC90_30505) | 156979..157290 | - | 312 | WP_011918375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTC90_RS30515 (PTC90_30510) | 157290..157550 | - | 261 | WP_011787805.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTC90_RS30520 (PTC90_30515) | 157720..158340 | + | 621 | WP_011787804.1 | recombinase family protein | - |
PTC90_RS30525 (PTC90_30520) | 158458..158790 | - | 333 | WP_011787803.1 | TraR/DksA C4-type zinc finger protein | - |
PTC90_RS30530 (PTC90_30525) | 158881..159738 | - | 858 | WP_055329964.1 | universal stress protein | - |
PTC90_RS30535 (PTC90_30530) | 159773..161263 | - | 1491 | WP_011787801.1 | SulP family inorganic anion transporter | - |
PTC90_RS30540 (PTC90_30535) | 161758..162078 | + | 321 | Protein_184 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaFOX-5 / blaCARB-2 / aadA2 / cmlA1 / qacE / sul1 / dfrA19 / ant(2'')-Ia / msr(E) | - | 1..178660 | 178660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11862.70 Da Isoelectric Point: 8.5341
>T272193 WP_011918375.1 NZ_CP117732:c157290-156979 [Klebsiella grimontii]
MPVTYHLTPDAQSDLIGIHRFTLAQWGTTQSKTYLSGLRQTIQLLAETPTLGKNRPEVRMNVFSFPYSSHVIYYIQHEHQ
FVVFGILHKSMVPLAHLAEREII
MPVTYHLTPDAQSDLIGIHRFTLAQWGTTQSKTYLSGLRQTIQLLAETPTLGKNRPEVRMNVFSFPYSSHVIYYIQHEHQ
FVVFGILHKSMVPLAHLAEREII
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I8S8S5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Z3MW28 |