Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 56142..56878 Replicon plasmid unnamed1
Accession NZ_CP117731
Organism Klebsiella grimontii strain 2022CK-00781

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag PTC90_RS28810 Protein ID WP_003026803.1
Coordinates 56396..56878 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag PTC90_RS28805 Protein ID WP_003026799.1
Coordinates 56142..56408 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC90_RS28760 (PTC90_28755) 52204..52566 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
PTC90_RS28765 (PTC90_28760) 52616..52966 - 351 WP_241181846.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
PTC90_RS28770 (PTC90_28765) 53324..53593 + 270 WP_004152102.1 hypothetical protein -
PTC90_RS28775 (PTC90_28770) 53581..54156 + 576 WP_004152103.1 hypothetical protein -
PTC90_RS28780 (PTC90_28775) 54187..54681 + 495 WP_004152104.1 DNA-binding protein -
PTC90_RS28785 (PTC90_28780) 54725..55093 + 369 WP_004152105.1 hypothetical protein -
PTC90_RS28790 (PTC90_28785) 55127..55330 + 204 WP_004152106.1 HHA domain-containing protein -
PTC90_RS28795 (PTC90_28790) 55379..55636 + 258 WP_004152107.1 hypothetical protein -
PTC90_RS28800 (PTC90_28795) 55712..55966 + 255 WP_004152108.1 hypothetical protein -
PTC90_RS28805 (PTC90_28800) 56142..56408 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
PTC90_RS28810 (PTC90_28805) 56396..56878 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
PTC90_RS28815 (PTC90_28810) 57079..58482 + 1404 WP_001567368.1 ISNCY-like element ISKpn21 family transposase -
PTC90_RS28820 (PTC90_28815) 58511..59143 - 633 WP_001567369.1 hypothetical protein -
PTC90_RS28825 (PTC90_28820) 59355..60239 + 885 WP_117030958.1 hypothetical protein -
PTC90_RS28830 (PTC90_28825) 60379..60663 - 285 WP_117030959.1 hypothetical protein -
PTC90_RS28835 (PTC90_28830) 60656..61150 - 495 WP_117030960.1 hypothetical protein -
PTC90_RS28840 (PTC90_28835) 61151..61387 - 237 WP_117030961.1 hypothetical protein -
PTC90_RS28845 (PTC90_28840) 61404..61778 - 375 WP_117030962.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..204852 204852


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T272191 WP_003026803.1 NZ_CP117731:56396-56878 [Klebsiella grimontii]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT272191 WP_003026799.1 NZ_CP117731:56142-56408 [Klebsiella grimontii]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References