Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5846101..5846711 | Replicon | chromosome |
Accession | NZ_CP117730 | ||
Organism | Klebsiella grimontii strain 2022CK-00781 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PTC90_RS28065 | Protein ID | WP_024360704.1 |
Coordinates | 5846101..5846475 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PTC90_RS28070 | Protein ID | WP_077253475.1 |
Coordinates | 5846472..5846711 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC90_RS28050 (PTC90_28045) | 5843256..5844158 | + | 903 | WP_004122548.1 | formate dehydrogenase subunit beta | - |
PTC90_RS28055 (PTC90_28050) | 5844155..5844790 | + | 636 | WP_004132860.1 | formate dehydrogenase cytochrome b556 subunit | - |
PTC90_RS28060 (PTC90_28055) | 5845134..5846063 | + | 930 | WP_004132861.1 | formate dehydrogenase accessory protein FdhE | - |
PTC90_RS28065 (PTC90_28060) | 5846101..5846475 | - | 375 | WP_024360704.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTC90_RS28070 (PTC90_28065) | 5846472..5846711 | - | 240 | WP_077253475.1 | CopG family transcriptional regulator | Antitoxin |
PTC90_RS28075 (PTC90_28070) | 5846917..5847834 | + | 918 | WP_024360706.1 | alpha/beta hydrolase | - |
PTC90_RS28080 (PTC90_28075) | 5847852..5848793 | - | 942 | WP_004127112.1 | fatty acid biosynthesis protein FabY | - |
PTC90_RS28085 (PTC90_28080) | 5848838..5849275 | - | 438 | WP_004132870.1 | D-aminoacyl-tRNA deacylase | - |
PTC90_RS28090 (PTC90_28085) | 5849272..5850132 | - | 861 | WP_024360708.1 | virulence factor BrkB family protein | - |
PTC90_RS28095 (PTC90_28090) | 5850126..5850725 | - | 600 | WP_024360709.1 | glucose-1-phosphatase | - |
PTC90_RS28100 (PTC90_28095) | 5850855..5851640 | - | 786 | WP_064342034.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14127.49 Da Isoelectric Point: 8.4571
>T272190 WP_024360704.1 NZ_CP117730:c5846475-5846101 [Klebsiella grimontii]
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWMEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITLYHL
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWMEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITLYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|