Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1264827..1265446 Replicon chromosome
Accession NZ_CP117730
Organism Klebsiella grimontii strain 2022CK-00781

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag PTC90_RS05930 Protein ID WP_004099646.1
Coordinates 1264827..1265045 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag PTC90_RS05935 Protein ID WP_004129911.1
Coordinates 1265072..1265446 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC90_RS05895 (PTC90_05895) 1260874..1261137 + 264 WP_004129897.1 type B 50S ribosomal protein L31 -
PTC90_RS05900 (PTC90_05900) 1261137..1261277 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
PTC90_RS05905 (PTC90_05905) 1261274..1261972 - 699 WP_004136044.1 GNAT family protein -
PTC90_RS05910 (PTC90_05910) 1262073..1263527 + 1455 WP_049085239.1 PLP-dependent aminotransferase family protein -
PTC90_RS05915 (PTC90_05915) 1263502..1263972 - 471 WP_004136048.1 YlaC family protein -
PTC90_RS05920 (PTC90_05920) 1263993..1264127 + 135 WP_223226911.1 hypothetical protein -
PTC90_RS05925 (PTC90_05925) 1264099..1264665 - 567 WP_049085237.1 maltose O-acetyltransferase -
PTC90_RS05930 (PTC90_05930) 1264827..1265045 - 219 WP_004099646.1 HHA domain-containing protein Toxin
PTC90_RS05935 (PTC90_05935) 1265072..1265446 - 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
PTC90_RS05940 (PTC90_05940) 1265915..1269061 - 3147 WP_004848339.1 multidrug efflux RND transporter permease subunit AcrB -
PTC90_RS05945 (PTC90_05945) 1269084..1270277 - 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T272183 WP_004099646.1 NZ_CP117730:c1265045-1264827 [Klebsiella grimontii]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT272183 WP_004129911.1 NZ_CP117730:c1265446-1265072 [Klebsiella grimontii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References