Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 349841..350618 | Replicon | chromosome |
| Accession | NZ_CP117730 | ||
| Organism | Klebsiella grimontii strain 2022CK-00781 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1Q8YX07 |
| Locus tag | PTC90_RS01590 | Protein ID | WP_044349292.1 |
| Coordinates | 349841..350218 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1Q8YWX6 |
| Locus tag | PTC90_RS01595 | Protein ID | WP_044349290.1 |
| Coordinates | 350259..350618 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC90_RS01570 (PTC90_01570) | 345103..345912 | - | 810 | WP_098140223.1 | polysaccharide pyruvyl transferase family protein | - |
| PTC90_RS01575 (PTC90_01575) | 346012..348234 | + | 2223 | WP_024360229.1 | glycosyltransferase | - |
| PTC90_RS01580 (PTC90_01580) | 349027..349224 | - | 198 | Protein_313 | restriction endonuclease subunit M | - |
| PTC90_RS01585 (PTC90_01585) | 349353..349844 | - | 492 | WP_044349294.1 | DUF5983 family protein | - |
| PTC90_RS01590 (PTC90_01590) | 349841..350218 | - | 378 | WP_044349292.1 | TA system toxin CbtA family protein | Toxin |
| PTC90_RS01595 (PTC90_01595) | 350259..350618 | - | 360 | WP_044349290.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PTC90_RS01600 (PTC90_01600) | 350643..350864 | - | 222 | WP_044349288.1 | DUF987 domain-containing protein | - |
| PTC90_RS01605 (PTC90_01605) | 350878..351357 | - | 480 | WP_044349286.1 | DNA repair protein RadC | - |
| PTC90_RS01610 (PTC90_01610) | 351369..351812 | - | 444 | WP_044349284.1 | antirestriction protein | - |
| PTC90_RS01615 (PTC90_01615) | 351892..352122 | - | 231 | WP_087776359.1 | DUF905 domain-containing protein | - |
| PTC90_RS01620 (PTC90_01620) | 352146..352970 | - | 825 | WP_044349280.1 | DUF932 domain-containing protein | - |
| PTC90_RS01625 (PTC90_01625) | 353607..354239 | + | 633 | WP_177340675.1 | inovirus Gp2 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 343940..396522 | 52582 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13849.76 Da Isoelectric Point: 6.9771
>T272181 WP_044349292.1 NZ_CP117730:c350218-349841 [Klebsiella grimontii]
MKILSDSPTRAAPSRPSPVEIWQTLLTYLLDQHYGLTLNDTPFGHDGVIQEHIGTGITLCDAVNLIVEKYKLVRIDRHGF
SADTQSPLIGSIDILRARKETGLMTRHGYRAITDITTGKYSEAGQ
MKILSDSPTRAAPSRPSPVEIWQTLLTYLLDQHYGLTLNDTPFGHDGVIQEHIGTGITLCDAVNLIVEKYKLVRIDRHGF
SADTQSPLIGSIDILRARKETGLMTRHGYRAITDITTGKYSEAGQ
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13346.19 Da Isoelectric Point: 6.9464
>AT272181 WP_044349290.1 NZ_CP117730:c350618-350259 [Klebsiella grimontii]
MSKKTTITTHDISEPWWGLRRSVSPCFGARLVQEGNRLNYLADRANFDGQFCDADLRHLDQAFPVLMKQLELMLTSGELN
PRHQHCVTLYAKGLTCEADTLGSHGYLYLAIYTTPATAA
MSKKTTITTHDISEPWWGLRRSVSPCFGARLVQEGNRLNYLADRANFDGQFCDADLRHLDQAFPVLMKQLELMLTSGELN
PRHQHCVTLYAKGLTCEADTLGSHGYLYLAIYTTPATAA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YX07 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YWX6 |