Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 448030..448683 | Replicon | chromosome |
| Accession | NZ_CP117728 | ||
| Organism | Acinetobacter baumannii strain 2022CK-00783 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PTC89_RS02180 | Protein ID | WP_000607077.1 |
| Coordinates | 448294..448683 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | PTC89_RS02175 | Protein ID | WP_001288210.1 |
| Coordinates | 448030..448287 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC89_RS02155 (PTC89_02155) | 443546..444553 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| PTC89_RS02160 (PTC89_02160) | 444572..444949 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| PTC89_RS02165 (PTC89_02165) | 445131..446621 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| PTC89_RS02170 (PTC89_02170) | 446670..447842 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| PTC89_RS02175 (PTC89_02175) | 448030..448287 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| PTC89_RS02180 (PTC89_02180) | 448294..448683 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
| PTC89_RS02185 (PTC89_02185) | 449453..450538 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| PTC89_RS02190 (PTC89_02190) | 450616..451182 | + | 567 | WP_000651538.1 | rhombosortase | - |
| PTC89_RS02195 (PTC89_02195) | 451370..453565 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T272178 WP_000607077.1 NZ_CP117728:448294-448683 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|