Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RHH
Location 10549..11102 Replicon plasmid unnamed2
Accession NZ_CP117725
Organism Enterobacter asburiae strain 2022CK-00757

Toxin (Protein)


Gene name relE Uniprot ID A0A1L5QZG5
Locus tag PTC87_RS23745 Protein ID WP_054471487.1
Coordinates 10549..10842 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A6N8S2B8
Locus tag PTC87_RS23750 Protein ID WP_054471486.1
Coordinates 10830..11102 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC87_RS23705 (PTC87_23705) 6274..7059 + 786 WP_054471491.1 P-type conjugative transfer protein TrbJ -
PTC87_RS23710 (PTC87_23710) 7075..7344 + 270 WP_054471490.1 entry exclusion lipoprotein TrbK -
PTC87_RS23715 (PTC87_23715) 7341..9002 + 1662 WP_054471489.1 P-type conjugative transfer protein TrbL -
PTC87_RS23720 (PTC87_23720) 9005..9262 + 258 WP_054471488.1 hypothetical protein -
PTC87_RS23725 (PTC87_23725) 9326..9559 + 234 WP_011997484.1 type I toxin-antitoxin system ptaRNA1 family toxin -
PTC87_RS23730 (PTC87_23730) 9774..10139 - 366 WP_226197071.1 hypothetical protein -
PTC87_RS23735 (PTC87_23735) 10173..10382 - 210 Protein_11 transcriptional regulator -
PTC87_RS23740 (PTC87_23740) 10379..10549 - 171 WP_165601277.1 hypothetical protein -
PTC87_RS23745 (PTC87_23745) 10549..10842 - 294 WP_054471487.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PTC87_RS23750 (PTC87_23750) 10830..11102 - 273 WP_054471486.1 CopG family ribbon-helix-helix protein Antitoxin
PTC87_RS23755 (PTC87_23755) 11429..12442 - 1014 WP_000845048.1 class 1 integron integrase IntI1 -
PTC87_RS23760 (PTC87_23760) 12600..13427 + 828 WP_001007673.1 oxacillin-hydrolyzing class D beta-lactamase OXA-2 -
PTC87_RS23765 (PTC87_23765) 13481..14062 + 582 WP_012695484.1 aminoglycoside N-acetyltransferase AAC(6')-IIc -
PTC87_RS23770 (PTC87_23770) 14059..14184 + 126 WP_022646489.1 hypothetical protein -
PTC87_RS23775 (PTC87_23775) 14301..14648 + 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
PTC87_RS23780 (PTC87_23780) 14642..15481 + 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaOXA-2 / aac(6')-IIc / qacE / sul1 / blaKPC-2 - 1..33750 33750


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-95)

Antitoxin

Ribbon-helix-helix protein, CopG

(3-40)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 10811.34 Da        Isoelectric Point: 5.1583

>T272176 WP_054471487.1 NZ_CP117725:c10842-10549 [Enterobacter asburiae]
VPQVIVTEGAAEGLERCRRFLAVKAPDAARRAGQAIERQFLLLETAPDIGRPFPEMPELRELVIAFGDSGYVALYRHEPA
DDAVYVLAFRHQKEAGY

Download         Length: 294 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10563.86 Da        Isoelectric Point: 8.0869

>AT272176 WP_054471486.1 NZ_CP117725:c11102-10830 [Enterobacter asburiae]
MATSLKIDDTLKGRVQHLASQRRRSPHWIMLEAIQQYVEREEARESFKQEALASWAAYKETGRHLTGQEVRTWLNTWGTN
DERAVPECHK

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1L5QZG5

Antitoxin

Source ID Structure
AlphaFold DB A0A6N8S2B8

References