Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 47307..47833 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117724 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | PTC87_RS22960 | Protein ID | WP_000323025.1 |
| Coordinates | 47307..47594 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PTC87_RS22965 | Protein ID | WP_000534858.1 |
| Coordinates | 47594..47833 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS22925 (42311) | 42311..42664 | - | 354 | WP_033147099.1 | type IV conjugative transfer system pilin TraA | - |
| PTC87_RS22930 (42861) | 42861..43502 | + | 642 | WP_032636186.1 | Arc family DNA-binding protein | - |
| PTC87_RS22935 (43535) | 43535..43930 | - | 396 | WP_023327730.1 | hypothetical protein | - |
| PTC87_RS22940 (44504) | 44504..45043 | + | 540 | WP_032636190.1 | lytic transglycosylase domain-containing protein | - |
| PTC87_RS22945 (45072) | 45072..45893 | - | 822 | WP_023327732.1 | DUF932 domain-containing protein | - |
| PTC87_RS22950 (45910) | 45910..46203 | - | 294 | WP_023327733.1 | hypothetical protein | - |
| PTC87_RS22955 (47081) | 47081..47254 | - | 174 | WP_233424125.1 | DUF5431 family protein | - |
| PTC87_RS22960 (47307) | 47307..47594 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| PTC87_RS22965 (47594) | 47594..47833 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PTC87_RS22970 (47858) | 47858..48163 | + | 306 | WP_001326990.1 | protein YdfV | - |
| PTC87_RS22975 (48366) | 48366..48698 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
| PTC87_RS22980 (49135) | 49135..50475 | - | 1341 | WP_004196353.1 | IS1202-like element ISEsa1 family transposase | - |
| - (52070) | 52070..52164 | - | 95 | NuclAT_0 | - | - |
| - (52070) | 52070..52164 | - | 95 | NuclAT_0 | - | - |
| - (52070) | 52070..52164 | - | 95 | NuclAT_0 | - | - |
| - (52070) | 52070..52164 | - | 95 | NuclAT_0 | - | - |
| PTC87_RS22990 (52224) | 52224..52598 | - | 375 | WP_023327673.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..172688 | 172688 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T272175 WP_000323025.1 NZ_CP117724:c47594-47307 [Enterobacter asburiae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|