Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4664293..4664909 | Replicon | chromosome |
Accession | NZ_CP117723 | ||
Organism | Enterobacter asburiae strain 2022CK-00757 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PTC87_RS22315 | Protein ID | WP_080277799.1 |
Coordinates | 4664293..4664664 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PTC87_RS22320 | Protein ID | WP_033146961.1 |
Coordinates | 4664667..4664909 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTC87_RS22300 (PTC87_22300) | 4661793..4662695 | + | 903 | WP_010436855.1 | formate dehydrogenase subunit beta | - |
PTC87_RS22305 (PTC87_22305) | 4662692..4663327 | + | 636 | WP_010436852.1 | formate dehydrogenase cytochrome b556 subunit | - |
PTC87_RS22310 (PTC87_22310) | 4663324..4664253 | + | 930 | WP_023309751.1 | formate dehydrogenase accessory protein FdhE | - |
PTC87_RS22315 (PTC87_22315) | 4664293..4664664 | - | 372 | WP_080277799.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTC87_RS22320 (PTC87_22320) | 4664667..4664909 | - | 243 | WP_033146961.1 | CopG family transcriptional regulator | Antitoxin |
PTC87_RS22325 (PTC87_22325) | 4665109..4666029 | + | 921 | WP_033146962.1 | alpha/beta hydrolase | - |
PTC87_RS22330 (PTC87_22330) | 4666038..4666979 | - | 942 | WP_033146963.1 | fatty acid biosynthesis protein FabY | - |
PTC87_RS22335 (PTC87_22335) | 4667024..4667461 | - | 438 | WP_033146964.1 | D-aminoacyl-tRNA deacylase | - |
PTC87_RS22340 (PTC87_22340) | 4667458..4668339 | - | 882 | WP_033146965.1 | virulence factor BrkB family protein | - |
PTC87_RS22345 (PTC87_22345) | 4668333..4668932 | - | 600 | WP_033146966.1 | glucose-1-phosphatase | - |
PTC87_RS22350 (PTC87_22350) | 4669021..4669491 | - | 471 | WP_033146967.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13687.90 Da Isoelectric Point: 6.9789
>T272174 WP_080277799.1 NZ_CP117723:c4664664-4664293 [Enterobacter asburiae]
MEHMAVFDTNILIDLFNNRVEAADAIDRTASHRAISLITWMEVMVGARKHGHEAKTATVMGVFEIIDITRDIAERSVILR
EKHGMKLPDAIILATAQSRSCPLISRNTKDFLGITGVVSPYQL
MEHMAVFDTNILIDLFNNRVEAADAIDRTASHRAISLITWMEVMVGARKHGHEAKTATVMGVFEIIDITRDIAERSVILR
EKHGMKLPDAIILATAQSRSCPLISRNTKDFLGITGVVSPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|