Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3899298..3899955 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | PTC87_RS18535 | Protein ID | WP_021242050.1 |
| Coordinates | 3899298..3899708 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V3PWU7 |
| Locus tag | PTC87_RS18540 | Protein ID | WP_010435322.1 |
| Coordinates | 3899689..3899955 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS18515 (PTC87_18515) | 3895291..3897024 | - | 1734 | WP_033146589.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PTC87_RS18520 (PTC87_18520) | 3897030..3897743 | - | 714 | WP_029740340.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PTC87_RS18525 (PTC87_18525) | 3897772..3898668 | - | 897 | WP_023309098.1 | site-specific tyrosine recombinase XerD | - |
| PTC87_RS18530 (PTC87_18530) | 3898770..3899291 | + | 522 | WP_023309099.1 | flavodoxin FldB | - |
| PTC87_RS18535 (PTC87_18535) | 3899298..3899708 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
| PTC87_RS18540 (PTC87_18540) | 3899689..3899955 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
| PTC87_RS18545 (PTC87_18545) | 3900250..3901230 | + | 981 | WP_033146590.1 | tRNA-modifying protein YgfZ | - |
| PTC87_RS18550 (PTC87_18550) | 3901305..3901964 | - | 660 | WP_033146591.1 | hemolysin III family protein | - |
| PTC87_RS18555 (PTC87_18555) | 3902130..3902441 | - | 312 | WP_033146592.1 | N(4)-acetylcytidine aminohydrolase | - |
| PTC87_RS18560 (PTC87_18560) | 3902493..3903224 | + | 732 | WP_029739204.1 | MurR/RpiR family transcriptional regulator | - |
| PTC87_RS18565 (PTC87_18565) | 3903341..3904774 | + | 1434 | WP_033146593.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T272173 WP_021242050.1 NZ_CP117723:c3899708-3899298 [Enterobacter asburiae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PWU7 |