Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3182447..3182973 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | PTC87_RS15135 | Protein ID | WP_000323025.1 |
| Coordinates | 3182447..3182734 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PTC87_RS15140 | Protein ID | WP_000534858.1 |
| Coordinates | 3182734..3182973 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS15120 (PTC87_15120) | 3179022..3179960 | - | 939 | WP_014170919.1 | 1-phosphofructokinase | - |
| PTC87_RS15125 (PTC87_15125) | 3179960..3181090 | - | 1131 | WP_033146038.1 | fused PTS fructose transporter subunit IIA/HPr protein | - |
| PTC87_RS15130 (PTC87_15130) | 3181452..3182390 | + | 939 | Protein_2968 | MFS transporter | - |
| PTC87_RS15135 (PTC87_15135) | 3182447..3182734 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| PTC87_RS15140 (PTC87_15140) | 3182734..3182973 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PTC87_RS15145 (PTC87_15145) | 3182998..3183303 | + | 306 | WP_001326990.1 | protein YdfV | - |
| PTC87_RS15150 (PTC87_15150) | 3183506..3183838 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
| PTC87_RS15155 (PTC87_15155) | 3184275..3185615 | - | 1341 | WP_004196353.1 | IS1202-like element ISEsa1 family transposase | - |
| PTC87_RS15160 (PTC87_15160) | 3185691..3185951 | + | 261 | Protein_2974 | MFS transporter | - |
| PTC87_RS15165 (PTC87_15165) | 3185948..3186202 | - | 255 | WP_033146563.1 | YkgJ family cysteine cluster protein | - |
| PTC87_RS15170 (PTC87_15170) | 3186367..3186939 | + | 573 | WP_008500940.1 | elongation factor P-like protein YeiP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T272171 WP_000323025.1 NZ_CP117723:c3182734-3182447 [Enterobacter asburiae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|