Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2998321..2998911 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PTC87_RS14315 | Protein ID | WP_033145927.1 |
| Coordinates | 2998321..2998653 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PTC87_RS14320 | Protein ID | WP_033145928.1 |
| Coordinates | 2998654..2998911 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS14290 (PTC87_14290) | 2993482..2994285 | - | 804 | WP_003036327.1 | TIGR02391 family protein | - |
| PTC87_RS14295 (PTC87_14295) | 2994307..2994789 | - | 483 | WP_003036324.1 | hypothetical protein | - |
| PTC87_RS14300 (PTC87_14300) | 2994865..2995803 | - | 939 | WP_003036321.1 | hypothetical protein | - |
| PTC87_RS14305 (PTC87_14305) | 2996639..2998000 | + | 1362 | WP_003036316.1 | HEPN/Toprim-associated domain-containing protein | - |
| PTC87_RS14310 (PTC87_14310) | 2998170..2998364 | + | 195 | WP_080277779.1 | hypothetical protein | - |
| PTC87_RS14315 (PTC87_14315) | 2998321..2998653 | - | 333 | WP_033145927.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PTC87_RS14320 (PTC87_14320) | 2998654..2998911 | - | 258 | WP_033145928.1 | antitoxin | Antitoxin |
| PTC87_RS14325 (PTC87_14325) | 2999203..2999592 | - | 390 | WP_033145929.1 | RidA family protein | - |
| PTC87_RS14330 (PTC87_14330) | 2999734..3000654 | + | 921 | WP_033145930.1 | LysR family transcriptional regulator | - |
| PTC87_RS14335 (PTC87_14335) | 3000730..3001032 | - | 303 | WP_029741460.1 | XRE family transcriptional regulator | - |
| PTC87_RS14340 (PTC87_14340) | 3001037..3001390 | - | 354 | WP_033145931.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PTC87_RS14345 (PTC87_14345) | 3001568..3002461 | - | 894 | WP_033145932.1 | LysR substrate-binding domain-containing protein | - |
| PTC87_RS14350 (PTC87_14350) | 3002632..3003240 | + | 609 | WP_080277780.1 | glutathione S-transferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11828.65 Da Isoelectric Point: 9.4051
>T272169 WP_033145927.1 NZ_CP117723:c2998653-2998321 [Enterobacter asburiae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTTTTGVIRCDQPRTI
DMSARNGMRLERIPDAVINEVLARLDAILN
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTTTTGVIRCDQPRTI
DMSARNGMRLERIPDAVINEVLARLDAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|