Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2329655..2330181 | Replicon | chromosome |
| Accession | NZ_CP117723 | ||
| Organism | Enterobacter asburiae strain 2022CK-00757 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | PTC87_RS11130 | Protein ID | WP_000323025.1 |
| Coordinates | 2329894..2330181 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | PTC87_RS11125 | Protein ID | WP_000534858.1 |
| Coordinates | 2329655..2329894 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTC87_RS11100 (PTC87_11100) | 2324857..2326047 | + | 1191 | WP_033145555.1 | cytochrome c biogenesis protein/redoxin | - |
| PTC87_RS11105 (PTC87_11105) | 2326052..2326810 | - | 759 | WP_033145556.1 | trans-aconitate 2-methyltransferase | - |
| PTC87_RS11110 (PTC87_11110) | 2327013..2328353 | + | 1341 | WP_004196353.1 | IS1202-like element ISEsa1 family transposase | - |
| PTC87_RS11115 (PTC87_11115) | 2328790..2329122 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
| PTC87_RS11120 (PTC87_11120) | 2329325..2329630 | - | 306 | WP_001326990.1 | protein YdfV | - |
| PTC87_RS11125 (PTC87_11125) | 2329655..2329894 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| PTC87_RS11130 (PTC87_11130) | 2329894..2330181 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| PTC87_RS11135 (PTC87_11135) | 2330511..2331149 | + | 639 | WP_033145557.1 | acyl-homoserine-lactone synthase | - |
| PTC87_RS11140 (PTC87_11140) | 2331164..2331856 | - | 693 | WP_033145558.1 | LuxR family transcriptional regulator | - |
| PTC87_RS11145 (PTC87_11145) | 2332159..2332743 | - | 585 | WP_033145559.1 | NUDIX domain-containing protein | - |
| PTC87_RS11150 (PTC87_11150) | 2332830..2333597 | + | 768 | WP_033145560.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PTC87_RS11155 (PTC87_11155) | 2333610..2333981 | - | 372 | WP_033145561.1 | VOC family protein | - |
| PTC87_RS11160 (PTC87_11160) | 2334069..2334497 | - | 429 | WP_033145562.1 | DUF4354 family protein | - |
| PTC87_RS11165 (PTC87_11165) | 2334534..2334977 | - | 444 | WP_033145563.1 | PACE efflux transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T272164 WP_000323025.1 NZ_CP117723:2329894-2330181 [Enterobacter asburiae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|